[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49033.1

[Show Plain Result]


## Summary of Sequence Search
    1::153
    3::145     2e-20  42%  159 aa  PF01862 PvlArgDC "Pyruvoyl-dependent arginine decarboxylase
    1::153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPGSLVPTAYGYI
PF01862         ----PKKIFFTKGVGEGKTKLASFDLALRDAGIENFNLVRVSSILPPGAEEEGLKLLPPGEILFCVMARA


                         .         .         *         .         .         .         .:140
query           VSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVE
PF01862         TSNEPGRLISAGIGVAIPKDESGGYISEHHGFGETEEAGEYAEDLAAEMLATRGGKIVETQNITQSATVE


                         +         .         .         .         .         *         .:210
query           Kxxxxxxxxxxxx
PF01862         K------------