[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49038.1

[Show Plain Result]


## Summary of Sequence Search
    1::208
  289::365     9e-05  25%  369 aa  PF09794 Avl9 "Transport protein Avl9"
    1::208

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFQEYRQIVYRIKGLDKPLSSLTRAERNDVLNLSIRQEEIEKHIGQQIQKSFKELQEGLEVVAEWVRLMK
PF09794         LFLQQKQLADVLVDLDEATINIHDPELRRALSLSTADLRFIDYLVKHVQETWDDAETGFEGSEEWIRLQF


                         .         .         *         .         .         .         .:140
query           EDAIKALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09794         EDYLLAL---------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09794         --------------------------------------------------------------------