[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49055.1

[Show Plain Result]


## Summary of Sequence Search
    1::72
    1::67      1e-09  48%   69 aa  PF11148 DUF2922 "Protein of unknown function (DUF2922)"
    1::72

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKTLELIFVNVAGDKVTLRVNDPRDDLQEAEVRTVMDTVVAKNVFTSTGGSLTGVAGARLVTRDVAELx
PF11148         --KTLELTFKTSDGKTVTISIPNPKEDLTEEEVKAAMDTIIAKNVFQSKGGDLVKKKSARIVETTTTEL-


                         .         .         *         .         .         .         .:140
query           xx
PF11148         --