[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49099.1

[Show Plain Result]


## Summary of Sequence Search
    1::128
    2::89      3e-21  50%  110 aa  PF08859 DGC "DGC domain"
    1::128

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxLFFSCSGGSNVGQIANDVCRQLTMDGQGKLFCLAGVGGKIGSFVEKAKDGSKVIVID
PF08859         -------------LVYSCSGCSNVGQLANEAAVELAREGDAEMSCLAGVGTGVEGLVKIARSARPIIAID


                         .         .         *         .         .         .         .:140
query           GCNLHCARKILENADIPINTHIVLTDLGVAKxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08859         GCPLACAKKILEEAGIKPDEHLVLTDLGIKK---------------------------