[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49162.1

[Show Plain Result]


## Summary of Sequence Search
    1::206
    1::75      8e-11  44%   81 aa  PF03458 UPF0126 "UPF0126 domain"
    1::206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFLNQPSYFYISL
PF03458         ---LLILDAIGLAAFAVSGALKALRKGLDLFGVIVLGVLTAVGGGIIRDVLLGRIPLVLRKDEIYATAAI


                         .         .         *         .         .         .         .:140
query           LAGFCTFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03458         LGALLYFL--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03458         ------------------------------------------------------------------