[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49306.1

[Show Plain Result]


## Summary of Sequence Search
    1::343
   23::324     4e-37  36%  328 aa  PF01594 UPF0118 "Domain of unknown function DUF20"
    1::343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLG
PF01594         ---------------------------------LPFLLALVLAYLLNPLVRFLERLGLPRGLAVLLVLLL


                         .         .         *         .         .         .         .:140
query           VVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVL
PF01594         LLLLIVLLLLLLVPQLISQISQLIENLPQYINKLQDWLNDLPESLPE--LENGLLDNLESSLTDLLSSLL


                         +         .         .         .         .         *         .:210
query           AIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG
PF01594         SSLLSSLSLLGSVGSFLLNLVLVLILLFYLLLDGERLRRGLLRLLPRKYRERIRRILREIDRTLSGYIRG


                         .         .         .         +         .         .         .:280
query           HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLI
PF01594         QLLVALILGVLTGIGLLILGVPYALLLGVLAGLLNLIPYIGPIIGAIPAAIIALLGGPTKALIVLIVFLV


                         .         *         .         .         .         .         +:350
query           IQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVxxxxxxxx
PF01594         VQQLEGNILRPKIVGRSVGLHPLWVLLALLIGGALFGIVGMILAVPLAAVLKVLL--------