[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49533.1

[Show Plain Result]


## Summary of Sequence Search
    1::2558
    6::203     2e-33  38%  211 aa  PF03534 SpvB "Salmonella virulence plasmid 65kDa B protein"
    6::167     5e-27  44%  167 aa  PF12256 TcdB_toxin_midN "Insecticide toxin TcdB middle/N-terminal
    4::102     8e-21  45%  148 aa  PF12255 TcdB_toxin_midC "Insecticide toxin TcdB middle/C-terminal
    1::2558

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGTANLSIPVQMSPCRDFEPKISLNYX
PF03534         -------------------------------------------SGAASYSLPLPVPPGRGLAPSLSLSYS
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXXRKTEKGIPRYNDTDTFLFSNAEDLVSKMVKNQEGSWVKEERHVEENRVGW
PF03534         SGSGNGPFGLGWSLGLPSISRRTRKGVPRYDDDDEFLGPDGEVLVP-VLDDQGQPEIDKRVSLGE---GY
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYGQSENARIADPHDNTRVFKWLIEKTYDAKGN
PF03534         TVTRYRPRIEGSFSRIERWSNGSGDFWRVTTKDGTTHLYGKTANARIADPNAPSRIAEWLLEESVDPNGN
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KIEYFYKQEDNENAPDNICEKNRTYATNKYVSSIKYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         HIYYQYKAEDS----TGVDEAEKARSAQRYLKRVRY----------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSIPLPETYSNLDQLGFADVKGNGTACLVFIKTGANA
PF03534         ----------------------------------------------------------------------
PF12256         ---------------------------------LALPLPPGVRFDCQLSVADINGDGTADLVLSSAGASP
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KQYYYDFSEGTKPYLLTGIDNNLGALTNIKYTSSVKYYLHDKMAGKPWKTKLPFPVQVVEKVESIDKISG
PF03534         ----------------------------------------------------------------------
PF12256         RHWYLDLSAG-KPDLLTSVTNGLGATTRLDYRPSTQFWLDDKRAGDPWYTYLPFPMYVVSRVEQDDGITG
PF12255         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LKLTTQYKYHDGFYDSXXXXXXXXXXXXXTDSEDFFTYAKPGLLENVAFYGLEEEHHVPPVLTKRWYHIG
PF03534         ----------------------------------------------------------------------
PF12256         GTLTTQYAYRHGYYDGAERGFRGFGRVETTDTDRGLT--------------------TPTVYTQTWFHTG
PF12255         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRALKGQVIREEVYALDYIEGRTG
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         -----------------------------------------------RALKGKLLRSEVYGLDGSPLAT-


                         .         .         .         +         .         .         .:980
query           HPYTVTETNFHVRLIQPLIGENRAVFSVYKKETVSFNYERNPNDPQIQHEFILAVDDFGNVKKSCRVFYP
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         RPYSVTESRYQVRLLQSAADNGYAVFLPHVLESLTYHYERIATDPRCSHAVVLRVDEYGNVLKSVSINYP


                         .         *         .         .         .         .         +:1050
query           RRATPKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         RRAKPAE---------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03534         --------------------------------------
PF12256         --------------------------------------
PF12255         --------------------------------------