[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49715.1

[Show Plain Result]


## Summary of Sequence Search
    1::621
    2::77      7e-18  42%   79 aa  PF02743 Cache_1 "Cache domain"
   10::165     2e-15  36%  210 aa  PF00015 MCPsignal "Methyl-accepting chemotaxis protein (MCP)
   21::68      7e-04  27%   69 aa  PF00672 HAMP "HAMP domain"
  128::209     5e-04  23%  210 aa  PF00015 MCPsignal "Methyl-accepting chemotaxis protein (MCP)(query 337->418)
    1::621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02743         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02743         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
PF02743         ---------TEPYIDAATGKLVITVSVPIYDADGKFIGVVGIDVSLDDLQKLLKKIKIGKTGYAFIVDNN
PF00015         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKVIGHPDAKAINGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02743         GTILAHPDKELIASD-------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxKMVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
PF02743         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF00672         --------------------------RLTRPLRRLAEAAERIAEGDLSVRIPVDGRDEIGELARAFNTMV
PF00015         --------------------------------------------------------EEAGEALEEIVESV


                         .         .         .         .         *         .         .:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLxx
PF02743         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF00672         DRLR------------------------------------------------------------------
PF00015         EEVSDLIEEIAAASEEQSAGIEEISAAVEEIAESTQENAASVEEVAAAAEELSELAEELKELVSKFKL--


                         .         .         +         .         .         .         .:490
query           xxxxxxxxEVIGAMEGIKSSTNEISRAISEVENQSKKXXXXXXXXXXXXXXXNXXXXXXXXXXXXXGEHG
PF02743         ----------------------------------------------------------------------
PF00015         --------EAVESMEEIAESVEEASEAIEELSESSEEIGEIVEVISDIAEQTNLLALNAAIEAARAGEAG
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
PF02743         ----------------------------------------------------------------------
PF00015         RGFAVVADEVRKLAEQSAEATKEIKELIEEIQEETEEAVESMEEINEEVEEGSELVEEAGEALEEIVESV
PF00672         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EELVEKMAQITRATITMSASIQNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02743         -------------------------------------------------------------
PF00015         EEVSDLIEEIAAASEEQSAGIEEI-------------------------------------
PF00672         -------------------------------------------------------------
PF00015         -------------------------------------------------------------