[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49801.1

[Show Plain Result]


## Summary of Sequence Search
    1::916
    4::110     2e-22  50%  112 aa  PF02518 HATPase_c "Histidine kinase-, DNA gyrase B-, and HSP90-like
    1::111     4e-17  44%  111 aa  PF00072 Response_reg "Response regulator receiver domain"
    1::916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNRLMQI
PF02518         ----------------------------------------------------------------NRLRQI
PF00072         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
PF02518         LRNLVSNAIKATPEGG-----RITVTIKLDGGDLTIEVEDNGIGIPPELLERLFEPFFQTDDSDSRKYGG
PF00072         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         TGLGLSIVRQLAELMGGTITVESKPGGGTTFTFTLP----------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
PF02518         ----------------------------------------------------------------------
PF00072         ------------------------ILIVDDDPVNRELLKRLLEKLGYVVTTAEDGEEALELLEEHRP-DL


                         +         .         .         .         .         *         .:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRxx
PF02518         ----------------------------------------------------------------------
PF00072         VLLDINMPGMDGLELLRRIRELEP--DIPIIVLTAYDDEEDAVRALEAGADDYLTKPFDPEELLAAIR--


                         .         .         .         +         .         .         .:980
query           xxxxxx
PF02518         ------
PF00072         ------