[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49907.1

[Show Plain Result]


## Summary of Sequence Search
    1::277
    7::220     5e-38  40%  222 aa  PF00497 SBP_bac_3 "Bacterial extracellular solute-binding proteins,
   57::92      2e-04  50%  200 aa  PF09084 NMT1 "NMT1/THI5 like"
    1::277

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFAPMGYRDE
PF00497         -------------------------------------------------------------YPPFSYVDE
PF09084         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
PF00497         NGKLVGFDIDLLKAIAKRLGFKVEFVPTSWNGLIPALQSGKADLAVAGLTITPEREKVVDFSDPYYESGI
PF09084         ----------------------------------------------------------------YQSEGQ


                         +         .         .         .         .         *         .:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
PF00497         VILVKKGISPIKSLEDLKGKRVGVVKGSSTEDFLRDPKGAKLV-TYDSYEEALKALAAGRVDAFLMDSPV
PF09084         ALVVRKDS-GIKSLADLKGKRIGVPGGSSTE---------------------------------------


                         .         .         .         +         .         .         .:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFxxxxxxx
PF00497         LDYLLARDPNKLVVVGGPLFDEPGYGAVRKKDSPLRDKINKALLELKEDGELQKLYDKWF-------
PF09084         -------------------------------------------------------------------