[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49938.1

[Show Plain Result]


## Summary of Sequence Search
    1::640
    8::109     5e-14  47%  148 aa  PF00535 Glycos_transf_2 "Glycosyl transferase family 2"
  114::202     8e-05  29%  578 aa  PF00755 Carn_acyltransf "Choline/Carnitine o-acyltransferase"
   23::129     1e-04  25%  549 aa  PF07079 DUF1347 "Protein of unknown function (DUF1347)"
    1::640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
PF00535         ------------NEEEYLERCLESLLNQTYEIIVVDDGSTDGTAEIAEELAARVIRLEENLGKAGARNAG
PF00755         ----------------------------------------------------------------------
PF07079         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         LRAAKGDYILFLDADDILDPDFLEKLVAALEENPVD----------------------------------
PF00755         ----------------------------------------------------------------------
PF07079         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF00755         ----------------------------------------------------------------------
PF07079         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF00755         ----------------------------------------------------------------------
PF07079         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF00755         ----------------------------------------------------------------------
PF07079         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERLIRMGNSS
PF00535         ----------------------------------------------------------------------
PF00755         ------------------------------------------------------------KRLLRNETLP
PF07079         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
PF00535         ----------------------------------------------------------------------
PF00755         PDVVRGQPLCMSQYKRLFGTTRIPGEERDELVTYPDSKHIVVLC---RGQFYKVDVLDEDGRLLSP-EEL
PF07079         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
PF00535         ----------------------------------------------------------------------
PF00755         EAQLQAILDDAEE---------------------------------------------------------
PF07079         ----------QQSEEIFSKIYKEKTSAPFLLKLGGRILFLNNLELMASLISELEQKYPQSAYLCLFKLAH


                         .         .         .         *         .         .         .:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF00755         ----------------------------------------------------------------------
PF07079         RQKHYDKAIDMLSEWFEHHPETKTHLLDTNVQELFSDFV-------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxx
PF00535         ----------
PF00755         ----------
PF07079         ----------