[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO49955.1

[Show Plain Result]


## Summary of Sequence Search
    1::426
   37::231     8e-12  29%  237 aa  PF01925 TauE "Sulfite exporter TauE/SafE"
    1::426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01925         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVGTDQFHIFAKAIMGTVIHKKLGNVNV
PF01925         ------------------------------------------AVATSLAAIFGTSLSGAIAHLRRGHIDW


                         +         .         .         .         .         *         .:210
query           ALAIAFLVGSGIGVTAGGTLNRALFNMNPVLSDFIISLVYVVMLGFLGFYSMYDFIKNKNTSGDAHGGPE
PF01925         RLALLLAPGSLLGALLGALLLV-------LLPDWLLKLLFGVLLLLVALYML------------------


                         .         .         .         +         .         .         .:280
query           GMTKLAQKLQGVNIAPMVKFDEDIVPGGRKISXXXXXXXXXXXXXXXXIMGVGGGFLTFPMFVYGLGVSS
PF01925         ----LKKKL---------KKEKEVL---KRLSLILLVLLGGFAGFLSGLLGIGGGFLLVPLLLYLLGLPP


                         .         *         .         .         .         .         +:350
query           FTTVGTDILQIIFTAGYSSIAQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMx
PF01925         KVAVATSLAMILFTS-LASLLGYLLLGYVDWPLALLLLVGALIGAYLGARLARRLPAKLLRRLFAILLL-


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01925         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxx
PF01925         ------