[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50098.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
    3::271     6e-09  25%  271 aa  PF02653 BPD_transp_2 "Branched-chain amino acid transport system /
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxLGVLEQGLLWGVMVLGVYITFRVLDFPDLTVDGSFTLGAAVAARMIIEGQDPWXXXXXXXXXXX
PF02653         ------LNGLTQGAIYALLALGLTLVFGITGLINLGHGAFFGLGAYAAALLLVLGGPPWLALLAALLVGA


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXNTRLRIAPLLSGILMMIALYSINLRVMGNKSMISLLRMDNIYTDVANIGVPAGMAVLTFGL
PF02653         LLGLLLGLLVLRLRGPYLIVTLLLMLILVGLALLLLGGLTLPGLLGFGGLLLPLGRL------VILLLVL


                         +         .         .         .         .         *         .:210
query           VXXXXXXXXXXAFLQTEIGMALRATGDNEQMIRSLGVNTNSTKILGLSMGNALVAMSGALVAQYQSYSDX
PF02653         LALVLALLLWLLLRRTRFGRALRAVGDNEEAARALGINVDRVKLLAFALSGALAGLAGALLALRLGSASP


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXLASVIVGEVVIGKRTLLRTLVAVLIGSIIYRAVIAAVMQLGLPTTDLKLFTALLVIFAMx
PF02653         SMGFGLGLDAIAAVVLG----GLGSILGAVLGALLLGLLENLGLA---LLGVPSEYQLVVIGLLLLLVL-


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ---------------------------