[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50103.1

[Show Plain Result]


## Summary of Sequence Search
    1::254
   92::153     6e-04  31%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::254

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIGYMIIxxxxx
PF00528         ---KDLIEAARALGASRWQTFRRVILPLALPGIITGLILAFIGALGEFVIAELLGGGPGLGSLLL-----


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         --------------------------------------------