[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50205.1

[Show Plain Result]


## Summary of Sequence Search
    1::474
   11::324     5e-21  30%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
    1::152     3e-08  28%  526 aa  PF06609 TRI12 "Fungal trichothecene efflux pump (TRI12)"
   18::366     3e-05  24%  402 aa  PF05977 DUF894 "Bacterial protein of unknown function (DUF894)"
   40::151     2e-04  28%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
    1::474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxVNKYTLAALAGVPLIMVLGNSMLIPVLPQMAKSLNVSQMQISLIITLFSVPAGLVIP
PF07690         ------------------------------LDRSILSPALPALAEDLGLSPSQVGLLLSAFLLGYALGSP
PF06609         -------------VSQAPVALFGGIPYFVLQASASALPILQDIGQSENWS-----LFSTLWTLGQAVSIL
PF05977         --------------------------LVSNLGDWIQTVALPWLVYELTGSPLAVGLVGAAQTLPILLLGL
PF00083         -------------------------------------------------------LVVSILFLGALIGAL


                         .         .         *         .         .         .         .:140
query           FAGFLSDRFGRKKIIIPGLFLYXXXXXXXXXXXXIFKENAFPWILGGRILQGIGAAGTAPIAMAFCGDLW
PF07690         PAGPLADRFGRRRVLLLGLLLF-----ALGSLLLAFASNSW-LLLVARFLQGLGAGGLFPAASALIADWF
PF06609         VVGRLSDRFGRRPFVIAGHILGLVGAIVGC------TANTFNTLIAGMALLGVG-AGPAELSPLFIGELM
PF05977         LAGVLADRFDRRRVLLAADLLRALLALLLALLALLGLLSLW-LLLALAFLLGIATAFFAPARQALVPELV
PF00083         FFGPLADRFGRKKALLLSLLL-----MAVGTLLIAFAPNP-ALLIVGRFLQGLGVGGESGVAPVYISEIA


                         +         .         .         .         .         *         .:210
query           KGKERAKSLGVIEASNGLGKVASPILGALIGLIAWWYXXXXXXXXXXXXXLGVWFICKEPETNKQPKKVN
PF07690         PPEERGRALGIFSAGGGLGAALGPLLGGLLASLGWRWAFLILAILGLLALLLALLLLPEP-----PPEAK
PF06609         SNKTKFLGLLVVSIPTIVATFAGPYLAQRLSIQGNW----------------------------------
PF05977         PREQLPAANALNSTTFNLARIIGPALGGLIALLAWAFLLNALSFLASALALLRLRRPEPPEPLPRESLLR
PF00083         PPKKRGFLVSLYQLFITLGILLAALVGYGLSLI-------------------------------------


                         .         .         .         +         .         .         .:280
query           EYVGSIKNIFKKKSPLLLTSFFAGSAALLILFGVLFFLSDYLEKKFGLDGVIKGAALAIPVLFMSTTSYV
PF07690         RLSPAEKLLERAPSPLLPLKLLLKNPVLWLLYGLLTFLPLYLQEVLGFSALQAGLLLALGGLVGAIGSLL
PF06609         ----------------------------------------------------------------------
PF05977         DLKEGLR--YVRRSPLL-----RGLLLLLALFGLFAGAVLALLPLFARD-ILGGGAAGYGLLL---AAFG
PF00083         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TGAXXXXXXXXXXXXXXXGHGLIGASLVTLPLFNNVYIFFAGISVAGIGTGLVLPCLNTLITSSTNKDER
PF07690         GGRLSDRLGPRRRLLLGLLLLLLGAGLLLLGLTSSPVWLLVALALLGFGLGLAFPALLALLS--------
PF06609         ----------------------------------------------------------------------
PF05977         VGA-LLGALLLARLRRRLGRGRLGLALLVLGLSPSLWLALLALALLGAAWAVANVSRNTLLQLATPDEMR
PF00083         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLVTSLYGSVRFLGVAAGPPLFGWLVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------
PF05977         GRVFSLYSLVFMGGMPLGALLAGALAE-------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ------------------------------------------------------
PF06609         ------------------------------------------------------
PF05977         ------------------------------------------------------
PF00083         ------------------------------------------------------