[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50573.1

[Show Plain Result]


## Summary of Sequence Search
    1::446
    1::195     1e-56  56%  196 aa  PF00448 SRP54 "SRP54-type protein, GTPase domain"
    2::101     2e-27  64%  101 aa  PF02978 SRP_SPB "Signal peptide binding domain"
    9::93      5e-07  34%  197 aa  PF07015 VirC1 "VirC1 protein"
   10::74      4e-06  48%   74 aa  PF02881 SRP54_N "SRP54-type protein, helical bundle domain"
    2::77      9e-05  46%  223 aa  PF08433 KTI12 "Chromatin associated protein KTI12 "
    1::446

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
PF00448         ----------------------------------------------------------------------
PF02978         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------
PF02881         -------------KKLSGKLFLTEKDIDELLEELEEALLEADVGVEVVEKLIENVK-ELVGR---KGLSP
PF08433         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AQQVIKIVRDELxxxxxxxxxxxxxxxxxPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
PF00448         -----------------------------PTVILLVGVNGVGKTTTIAKLAARLKKKGKKVLLVAADTFR
PF02978         ----------------------------------------------------------------------
PF07015         ------------------------------------GKGGAGKTTAAVNLASALAARGARVGLIDADPNR
PF02881         GQEVKKILKEEL----------------------------------------------------------
PF08433         -------------------------------LIILTGLPGSGKSTRARQLAKLLEAK-RYKVHIVSD---


                         +         .         .         .         .         *         .:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
PF00448         AAAVEQLKTWGERLGVPVFAQGTADPAAVAKDAIEAAKARGYDVVLIDTAGRLQNDENLMEELKKIKRVI
PF02978         ----------------------------------------------------------------------
PF07015         PLARWAENALRSGTWDPLCEVYAAEEVALLEDAYEDAELSGFDFVLVDTEG-------------------
PF02881         ----------------------------------------------------------------------
PF08433         -----------DDLRIPVYSRSEKEARAVLYSAVKRALSKG-DLVILDS---------------------


                         .         .         .         +         .         .         .:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
PF00448         APDEVLLVLDATTGQDAVNQAKAFNEALGLTGVILTKLDGTAKGGAALSIAAVTGKPIKFIGVGEKVDDL
PF02978         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF08433         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EPFYPDRMADRILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFNLEDFLEQMQQVKKLGPLEQVLGM
PF00448         EPFDPDRFVSRLL---------------------------------------------------------
PF02978         ---------------------------------------------FDLNDFLEQLQQIKKMGPLSKIMGM
PF07015         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF08433         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
PF00448         ----------------------------------------------------------------------
PF02978         IPGMGKMLPSGADEQEDEKKLKRMEAIIDSMTPEERENPELLNGSRKRRIARGSGTSVQEVNELLKQFRQ
PF07015         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF08433         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TRKMMxxxxxxxxxxxxxxxxxxxxx
PF00448         --------------------------
PF02978         MRKMM---------------------
PF07015         --------------------------
PF02881         --------------------------
PF08433         --------------------------