[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50700.1

[Show Plain Result]


## Summary of Sequence Search
    1::635
    5::181     2e-22  41%  183 aa  PF00009 GTP_EFTU "Elongation factor Tu GTP binding domain"
    3::49      1e-11  62%   50 aa  PF09107 SelB-wing_3 "Elongation factor SelB, winged helix "
    4::50      2e-07  49%   58 aa  PF09106 SelB-wing_2 "Elongation factor SelB, winged helix "
    1::161     2e-05  30%  188 aa  PF02421 FeoB_N "Ferrous iron transport protein B"
    1::105     2e-05  38%  105 aa  PF01926 MMR_HSR1 "GTPase of unknown function"
    1::635

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
PF00009         -----IGIIGHVDHGKTTLTDRLTGIIDDKLKAERERGITIDSAAWSFETKK-YLINIIDTPGHVDFIKE
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         ---LTIALVGNPNVGKTTLFNALTGA---RQHVGNWPGVTVEKKEGKFKL-GGKQVTLVDLPGTYSLSPY
PF01926         --------------GKSTLFNALTGRA--RAKVANYPGTTRDPNVGVVEVKDGTQIELVDTPG---LIKG


                         .         .         *         .         .         .         .:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
PF00009         MITGLSQADGAVLVVDAGEGVEPQTREHLLLAFTLGVPL-IVVVNKMDRTEEARFEEIKKEVSQSLLKKI
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         SLDEQVARDYLLVIINVVDATNLERNLYLTL-QLLEL--GIPVVVALNMMDEAEKRGIKIDIKKLSK---
PF01926         ASKGEGELDAILHVVDAFE---PDNENDLEIIDLLRLKKVIVVLNK------------------------


                         +         .         .         .         .         *         .:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         PAAVPVVPISALHGDGVLTLLEAIDAY-------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         LLGVPVVPTSARKGEGIDELKEAIDELAE-----------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAM
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ------------------------------LLAEYHEENPLRPGMDKEELRSRLALGLDPKLFDALLEAL
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EIDGLLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         LAEGLLK---------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxEYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGD
PF00009         ----------------------------------------------------------------------
PF09107         ---------------------------ELLAENGPITVAEFRDALGLSRKYAIPLLEYFDREGFTRRVGD
PF09106         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           NRVLx
PF00009         -----
PF09107         KRVL-
PF09106         -----
PF02421         -----
PF01926         -----