[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50704.1

[Show Plain Result]


## Summary of Sequence Search
    1::586
    1::486     8e-93  41%  508 aa  PF02652 Lactate_perm "L-lactate permease"
  142::266     3e-05  25%  298 aa  PF03553 Na_H_antiporter "Na+/H+ antiporter family"
  317::402     4e-04  33%  412 aa  PF06808 DctM "DctM-like transporters"
    1::586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxLSAFVASIPISFLFFTLYSRVRIHIAGFLTLLVTTGVAIFVYGMPFKLAAWSSFYG
PF02652         --------------LSALLALLPILVLFILLVVKMKAHKAALIALAVAVLIALFVFGMPVTLALAATLEG
PF03553         ----------------------------------------------------------------------
PF06808         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GMTGMFSIGWIMLSSLFLYKLTVKTGQIHIITWSIQSITRDHRLQCLLVALCLGAFLENLAGYSTSVAIT
PF02652         ALYGLFPILWIIFGAIFLYNLTVKSGAFDIIRRSLTSISPDRRLQVLLIAFGFGAFLEGAAGFGTPVAIT
PF03553         ----------------------------------------------------------------------
PF06808         -----------------------------------------------LILLVLGMFLDTTAIIIIVAPIL


                         +         .         .         .         .         *         .:210
query           SGILVALGFRPIYAAVLCLITSISFGFMGVPIITAGLTSDIDMMAVSQMVGRQLPILSFLLPFWLVFILA
PF02652         APLLVGLGFPPLAAAGLCLIANVAFGAVGTPIIVGAQVTGLDALEIGAMVGLQLPFLSLLVPFLLVFLMD
PF03553         ----------------------------------------------------------------------
PF06808         APVLVALGIDPIWFGILVFV-NLQIGFLTPPV-------GLALFVAAGVAGVTLDIYRGVLPFVLIQLLA


                         .         .         .         +         .         .         .:280
query           GWKGTKEVWLPILVCGISFAGVQWFAANYIFLSIVNTLAAVTTMIIMVFFLRNWQPKDVWHSQKTSSFYP
PF02652         GWKGIKETWPAALVAGLSFAIPQFLTANFLGPELPDIIGSLVSLAALVLFLKVWQPKEIWDFADEEEAAA
PF03553         ----------------------------------------------------------------------
PF06808         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NEKISFSTVLSAWLPYIIMTIFIINWSFKPVQDFLNTFTVYVAVSTLNNTIIASGKPIEVYXXXXXXXXV
PF02652         EWTGTGMSILKAWSPYILLTVLVVLWRIPLFKALFAALA-----STFLHNLVLKIPPIAASFKFDWLSAP
PF03553         ----------------------------------------------------------------------
PF06808         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GTVIFISAIINAYIYKVCHKELITLLGQAVRNLFLPLVGISLIIGVSYLMNWSGMIASMANVIASANGLL
PF02652         GTAILLAALITILILRMSPKEAKEAFGETLKQLKPPILTIGFVLALAYVMNYSGMSSTLALALAGTGAAF
PF03553         -------------------KELDDLLSRGMKSMLPTILILILAWGFGGVLEALGGLGSLVNSLIKSKGLL
PF06808         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PMFAPILGWLGVFITGSDVSSNTLMAKLQANTAQIVGFDPVLTVAANHSGGAVAKMISPEAIGAAASATG
PF02652         PFFSPFLGWLGVFLTGSDTSSNALFGSLQATTAQQLGLSPVLLVAANTVGGVAGKMISPQSIAIACAAVG
PF03553         PLSTFLLGALINFATGTSWGTIIILGPIAKPLAEKLGLSPLALARALEDGGTFGDHLSPWSDTTILSSSG
PF06808         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LNGREDDIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02652         LVGKEGEI--------------------------------------------------------------
PF03553         L---------------------------------------------------------------------
PF06808         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF02652         --------------------------
PF03553         --------------------------
PF06808         --------------------------