[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50761.1

[Show Plain Result]


## Summary of Sequence Search
    1::227
    1::64      9e-14  61%  218 aa  PF01555 N6_N4_Mtase "DNA methylase"
    1::227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01555         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVKMIYIDPPYNTGND
PF01555         -------------------------------------------------------VDLIYIDPPYNTGKD


                         +         .         .         .         .         *         .:210
query           FIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDN
PF01555         Y-----------EAFFNYG---------------DKKSHSDWLEFMYPRLKEARRLLKPDGSIFVSIDDN


                         .         .         .         +         .         .         .:280
query           EVENLxxxxxxxxxxxx
PF01555         EVAYL------------