[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50766.1

[Show Plain Result]


## Summary of Sequence Search
    1::80
   40::103     1e-12  52%  103 aa  PF08291 Peptidase_M15_3 "Peptidase M15 "
   75::144     5e-08  38%  151 aa  PF05951 Peptidase_M15_2 "Bacterial protein of unknown function
    1::80

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGLYPSQCFVHVD
PF08291         ------ITSGYRSPALNRAVGGASNSQHLYGDAADIVVPGVSPEELARFARSLGFFGIGIGEHSGFVHVD
PF05951         -----QVISGYRSPATNRSRGVAKKSLHMKGQAMDFRIPGVSLSKLRKAALSLRAGGVGYYPRSGFVHID


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxx
PF08291         ----------
PF05951         ----------