[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50796.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
    1::69      7e-13  52%   70 aa  PF04542 Sigma70_r2 "Sigma-70 region 2 "
    8::54      2e-07  57%   54 aa  PF08281 Sigma70_r4_2 "Sigma-70, region 4"
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
PF04542         ----------------------LVERYLPLVYRIARRLLGDGADAEDLVQEGFLGLWRALDKFRG-ASFS
PF08281         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TWIYHITVNVCRDELRKRQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNTLSD
PF04542         TWLYTIARNLILDHLRRRR---------------------------------------------------
PF08281         ----------------------------------------------------------------LEELPE


                         +         .         .         .         .         *         .:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALxxxxxxxxxxxxxxxxxxx
PF04542         ------------------------------------------------------------
PF08281         RQREVLLLRYLEGLSYEEIAEILGISEGTVKSRLHRARKKL-------------------