[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50877.1

[Show Plain Result]


## Summary of Sequence Search
    1::233
    9::67      1e-12  64%  151 aa  PF07685 GATase_3 "CobB/CobQ-like glutamine amidotransferase domain"
   28::83      1e-04  44%  135 aa  PF01965 DJ-1_PfpI "DJ-1/PfpI family"
    1::233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
PF07685         ------------------------------------------DLVVLPGGFSYLDDL---ALARNSGLME
PF01965         ---------------------------------------EDYDALVVPGGHGPADDLRD------SPELL


                         .         .         *         .         .         .         .:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07685         AIREFAEKGGPVLGICGGFQMLGEAGGIPG----------------------------------------
PF01965         ALLRFAAAGKPVAAICHGPALLAAAGLLDG----------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07685         ----------------------------------------------------------------------
PF01965         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxx
PF07685         -----------------------
PF01965         -----------------------