[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50885.1

[Show Plain Result]


## Summary of Sequence Search
    1::513
    4::93      1e-31  67%   93 aa  PF00958 GMP_synt_C "GMP synthase C terminal domain"
    2::181     2e-21  33%  185 aa  PF00117 GATase "Glutamine amidotransferase class-I"
    8::177     4e-13  34%  208 aa  PF02540 NAD_synthase "NAD synthase"
   59::214     1e-08  37%  214 aa  PF07722 Peptidase_C26 "Peptidase C26"
   36::168     2e-04  28%  184 aa  PF01174 SNO "SNO glutamine amidotransferase family"
   34::141     5e-04  30%  233 aa  PF02578 Cu-oxidase_4 "Multi-copper polyphenol oxidoreductase
    1::513

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
PF00958         ----------------------------------------------------------------------
PF00117         ----------LIDAYDSFTENLARALRELGAEVEVVPNDSDALEILLLNPDGILVSGGPGSP-GDIEGKI
PF02540         ----------------------------------------------------------------------
PF07722         ---------------------------------------------------GLLLTGGADSLYGEESGAI
PF01174         ---------------------------------------------------GLIIPGGESTTMGKRYGLL
PF02578         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
PF00958         ----------------------------------------------------------------------
PF00117         EAIKYENGVPVLGICLGMQLLAEAFGGKVVKAKVPHHGGNMRLGHDGSPLFYGLPEVFYVRHRHSYEVNP
PF02540         ----------------------------------------------------------------------
PF07722         DPAALERGIPVLGICRGMQLLNVALGGTLIPLDHREHGPSHEVRIEPGSLLARLLGAEEIMVNHHQAIKR
PF01174         EPEFIKSGKPVFGTCAGLILLAKEIEGQDITVRRNAFGR-QVDSFEADLDIKGLGEPFPAVFIRAPYIEE
PF02578         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFxxxxxxxxxxxxxxxxxxxxVK
PF00958         ----------------------------------------------------------------------
PF00117         LPEGLEVLATSEDGTIMAIVHKDNPFFGVQFHPESSSTPGGLHLLFNF----------------------
PF02540         --------------------------------------------------------------------LR
PF07722         LGPGLRVEATAPDGLIEAIESPDAPYFGVQWHPE------------------------------------
PF01174         VGDGVEVLAEVDGRIVAVR---QGNILATSFHPEL-----------------------------------
PF02578         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         DYLRKSGFKGVVLGLSGGVDSSVAAALAHKAIGDNVTAVFMPSG-LSSEETAQDAKELAEALGVNHITVD
PF07722         ----------------------------------------------------------------------
PF01174         ----------------------------------------------------------------------
PF02578         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         AVDAFLKALEPATLEDLALENIQARIRMVL------LYALANLLGGLVLGTGNKSELAVGYFTKYGDGAG
PF07722         ----------------------------------------------------------------------
PF01174         ----------------------------------------------------------------------
PF02578         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         D---------INPIGDLYKTQVRELARYLGIPEEIIEKPP------------------------------
PF07722         ----------------------------------------------------------------------
PF01174         ----------------------------------------------------------------------
PF02578         ----------------------RRLAAALGLPPRLVWLNQVHG----TRVVDVDEAPPESAVPEADALVT


                         .         .         +         .         .         .         .:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
PF00958         --IKKAGLYDKIWQAFAVLLPVRSVGVQGDGRTYSYVVVLRAVITNDFMTADPAHIPYEVLEKISNRIIN
PF00117         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF01174         ----------------------------------------------------------------------
PF02578         DQVALAVMTADCLPVLLADPDGGVVAAAHAGRGLAAGILEKTV---EAMRAKFGADPEDILAAI------


                         *         .         .         .         .         +         .:560
query           EVAEINRVVYDITSKPPGTIEWx
PF00958         EVPGISRVVYDLTSKPPGTIEW-
PF00117         -----------------------
PF02540         -----------------------
PF07722         -----------------------
PF01174         -----------------------
PF02578         -----------------------