[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50894.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
    1::189     2e-39  49%  195 aa  PF01739 CheR "CheR methyltransferase, SAM binding domain"
    4::54      1e-06  37%   57 aa  PF03705 CheR_N "CheR methyltransferase, all-alpha domain"
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNxxxxxxxxxxxxxNVSE
PF01739         ------------------------------------------------------------------NVTE
PF03705         --DFERFRELLYQRTGIDLSDYKRALLKRRLERRMRALGLESFSEYLDLLESD-----------------


                         .         .         *         .         .         .         .:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
PF01739         FFRDPEHFEALREEVLPPLLARRGRLRIWSAGCSTGEEPYSLAMLLLEALPGLRVEILATDIDTRVLEKA
PF03705         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
PF01739         RAGIYPEESLRGLPPEYLKRYFTREGGGYRVKPELREMVTFAQHNLLDSDPPFGFDLIFCRNVLIYFDRE
PF03705         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVxxxxxxxx
PF01739         TQRRVLRRFHESLKPGGYLFLGHSESLSGLTDL-FELV--------
PF03705         ----------------------------------------------