[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO50917.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    2::109     3e-28  58%  110 aa  PF01706 FliG_C "FliG C-terminal domain"
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01706         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01706         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01706         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
PF01706         ---------ESLREEDPELAEKIREKMFVFEDLLRLDDRAIQRLLREVDNDDLALALKGASDELREKILS


                         .         *         .         .         .         .         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVIxxxxxxxxxx
PF01706         NMSKRAAEMLREDLEALGPVRLSDVEEAQREIVNIVRRLAEEGEIVL----------