[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO51003.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    3::220     2e-41  44%  225 aa  PF04452 Methyltrans_RNA "RNA methyltransferase"
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
PF04452         -----------------LTGEEAHHLKRVLRLKVGDEIRLFDGRGGEYLAEITEIGKKSVTVKIIEQLEV


                         .         .         *         .         .         .         .:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
PF04452         PRELPLRLTLAQALPKGDRMEWIIQKATELGVARIIPLISERSVVKLDGERAEKKLERWQKIAIEAAEQS


                         +         .         .         .         .         *         .:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPXXXXXXXXXXX
PF04452         GRNRLPEIEPPISLKDLLKEL-PDADLRLVLHEEAAKSLGELAELLAALRRRVLLLIGPEGGFSPEEIEL


                         .         .         .         +         .         .         .:280
query           XXXXXXYPVTLGSRILRTETAGPAALxxxxxxxxxxx
PF04452         LRAAGFQPVSLGPRILRTETAALAAL-----------