[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO51163.1

[Show Plain Result]


## Summary of Sequence Search
    1::204
    7::210     6e-23  36%  210 aa  PF01865 PhoU_div "Protein of unknown function DUF47"
    1::204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxDIFFETFKAIAENITRAAEDFSAEIHNPSSDKRGLTNLQNYEKTGDRYTHTIIKELNKTFVTPL
PF01865         ------DPFFELLEEVAECLVELAELLEELLEGDWEDEEAREEIKELEHEADELKREIIRELNKTFITPI


                         .         .         *         .         .         .         .:140
query           EREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQEVEKSIGKLVTKRFLEIRTH
PF01865         DREDILRLATSLDDVLDLLEDAAGRLSLYRVEELDEEFLELADLIVKAAEELVEAVEELLLEKGFRGREL


                         +         .         .         .         .         *         .:210
query           AVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYEMLEEVTDACEDVANILESILMRxx
PF01865         IIEINRLESEADELYRELLKKLFSLEDDPIEVIKLKEIYELLEDIADRCEDVANRLEGIVLR--