[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO48556.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1w44A.bssp"

## Summary of PDB Search
:371
    6e-15  23%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-12  18%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    8e-11  23%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-09  24%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-04  15%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    4e-04  24%  1w44A  [c.37.1.11] NTPASE P4
:371

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
1f2t.1          MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWLRIKDIKKDEFTKVGARDTYI
1ii8.1          MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTY
1w1wA           -RLVGLELSNFKSYRGVTKVGESNFTSIIGPNGSGKSNMMDAI-------SFVLGVLKDLIYRGPQSAYV
1e69A           MRLKKLYLKGFKSFGRPSLGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSA---
1n25A           --LPKMDSVVYDFLKCMVYIPKKRYWLFKGPIDSGKTTLAAALLELC-GGKALNVNLPLDRLNFELGVAI
1w44A           ----------------------SGMVIVTGKGNSGKTPLVHALGEALGG---KD--KYATVRFGEPLSGY


                         .         .         *         .         .         .         .:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
1f2t.1          DLIFEKDGTKYRITRRFLKGEIH-----------------------------------------------
1ii8.1          IDLIFEKDGTKYRITRRFLKGYSS----------------------------------------------
1w1wA           KAFYQKGNKLVELMRIISRNGDSYKIDGKTVSYKDYSIF-------------------------------
1e69A           ----------------------------------------------------------------------
1n25A           DQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGS-------------VKVNLEKKHLNKRTQIFP
1w44A           NTDFNVFVDDIARAM-------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
1f2t.1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1n25A           PGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLL---EKRIIQSGIALLLMLIWYRPVAEFA
1w44A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LTGGTEELQAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f2t.1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1n25A           QSIQSRIVEW------------------------------------------------------------
1w44A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f2t.1          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxx
1f2t.1          ---------------------
1ii8.1          ---------------------
1w1wA           ---------------------
1e69A           ---------------------
1n25A           ---------------------
1w44A           ---------------------