[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO48689.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "1e7pB1.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "1hfeL2.bssp"
#ERROR : Can't open dsspfile "1kqfB1.bssp"

## Summary of PDB Search
:334
    8e-09  17%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    3e-06  14%  1xerA  [d.58.1.3] FERREDOXIN
    7e-06  24%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    2e-05  14%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-05  19%  1e7pB1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:107 --
    4e-05   9%  1d0cA  [d.174.1.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    5e-05  14%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    5e-05  11%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    1e-04  16%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    4e-04  18%  1hfeL2 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE (E.C.1.18.99.1) L:2
    5e-04  26%  1kqfB1 [d.58.1.5] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1e7pB1          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1e7pB1          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLA
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
2fug91          --------------------------------------------------------------------LK
1b0pA5          ----------------------------------------------------------------------
1e7pB1          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
2fug34          --------------------------------------------------------------------LS
1gt8A5          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKLGGMFEHPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPR
1nekB1          ------PEQREKLDGLYECILCACCSTSCPSFWW--NPDKFIGPAGLLAAYRFLI---------------
1xerA           ------PNYRTNRQVVGEHSGHKVYGPVEPPXVL-------GIHGTIVGVDFDLCIADGSCINACPVNVF
2fug91          PRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIY---------------------------------VE
1b0pA5          EKRGVAINVPQWVP--ENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANFTALEAKGKELKGYKFRIQI
1e7pB1          ------------------------------------------------------------------DPHD
1d0cA           --------------------------------VASTGTYHLRESELV----FGAKQAWRNAPRCVGRI--
1kf6B1          -------AQMAKYHQFSGCINCGLCYAACPQFGLNP------------EFIGPAAI----------TLAH
2fug34          DVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKLPVYTRFEFTRRHVDKHHPLSPFVI
1gt8A5          ---------------------GKALQYLGTFGELSNIEQVVAVIDEEMCINCGKCYMT------------
1hfeL2          ----------------RTVMERIEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGE
1kqfB1          ----------------STCIGCKACQVACSEWN--DIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQN


                         .         *         .         .         .         .         +:350
query           PGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRxxx
1nekB1          DSRDTETDSRLDGLSDAF----SVFRCHSIMNCVSVCPKGLNPTRAIGHIK---
1xerA           QWYDTPG----HPASEKKADPVNEQACIFCMACVNVCPVA--------------
2fug91          PAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTG--------------
1b0pA5          NTLDCMGCGNCADALVMQPLDTQRDAQVPNLEYAARIP----------------
1e7pB1          ERTDEDYYELIGDDDGVF-------GCMTLLACHDVCPKNLPLQSKIAYLR---
1d0cA           ---QWGKLQVFDARDCSSAQEMFTYICNHIKYAT--NRGNLRSAITVFPQR---
1kf6B1          RYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGK---
2fug34          VPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGLLDLTARFRAR---
1gt8A5          ---CNDSGYQAIQFDPETHLPTVTDTCTGCTLCLSVCPII--------------
1hfeL2          PHSI-----------------PHIEACINCGQCLTHCPEN--------------
1kqfB1          GKLEWLIRKDAIIQYANGIVDFQSENCIGCGYCIAGCPFN--------------