[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO48707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ou5A2.bssp"
#ERROR : Can't open dsspfile "1ou5A1.bssp"
#ERROR : Can't open dsspfile "1mivA2.bssp"
#ERROR : Can't open dsspfile "1mivA1.bssp"
#ERROR : Can't open dsspfile "1vfgA1.bssp"
#ERROR : Can't open dsspfile "2hekA1.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"

## Summary of PDB Search
:472
    3e-15  26%  1ou5A2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:-1 -- 150
    9e-15  18%  1ou5A1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:151 -- 354
    3e-12  35%  1mivA2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:1 -- 139
    9e-10  27%  1mivA1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:140 -- 404
    2e-09  24%  1vfgA1 [a.173.1.1] POLY A POLYMERASE A:137 -- 351
    4e-05  24%  2hekA1 [a.211.1.1] HYPOTHETICAL PROTEIN A:1 -- 369
    7e-04  30%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
:472

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
1ou5A2          -------------ELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITAR
1ou5A1          ----------------------------------------------------------------------
1mivA2          -------------DAYFVGGAVRDLLLGRPIGDVDIATSALXAIFPKTIDVGSKHGTVVVVHKGKAYEVT
1mivA1          ----------------------------------------------------------------------
1vfgA1          ----------------------------------------------------------------------
2hekA1          ----------------------------------------------------------------------
1vfgA2          ------------LRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKEGVNVHPFPEFGTAHLKIGKLKL


                         .         .         *         .         .         .         .:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRAASSSSI
1ou5A2          LHEENFEITTLRIFTWQKDAERRDLTINSMFLG-------------------------------------
1ou5A1          ----------------------------------------------------------------HAKQRI
1mivA2          T--FKTDGSVTFVRSLEEDLKRRDFTXNAIA---------------------------------------
1mivA1          --------------------------------------------------------------------RF
1vfgA1          --------------------------------------------------------------RVLHPVSF
2hekA1          ----------------------------------------------------------------------
1vfgA2          EFATARRETVEPASLKE-DLIRRDFTINAMA---------------------------------------


                         +         .         .         .         .         *         .:210
query           QQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHF
1ou5A2          ----------------------------------------------------------------------
1ou5A1          QEDYLRILRYFRFYGRIVDDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLI-YDLDV
1mivA2          ----------------------------------------------------------------------
1mivA1          REDALRXXRAVRFVSELGFALAPDTEQAIVQNAPLLAHISVERXTXEXEKLLGGPFAARALPLL-AETGL
1vfgA1          IEDPVRILRALRFAGRLNFKLSRSTEKLLKQNLGLLKEAPRGRLINEIKLALRED-RFLEILELYRKYRV
2hekA1          ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVL
1ou5A2          ----------------------------------------------------------------------
1ou5A1          APYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDL
1mivA2          ----------------------------------------------------------------------
1mivA1          NAYLKEKQLRLAA---------------------------------------------------------
1vfgA1          LEEIIEG---------------------------------------------------------------
2hekA1          -----------------PSAQHTRFEHSLGVYHITERICESLKVKEKE--------------------LV
1vfgA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKLSRxxxxxxxxxxxxxxxxxxxxxxx
1ou5A2          ----------------------------------------------------------------------
1ou5A1          IKATDSSDPLK-----------PYQDFIIDSREPDATTRVCELLKYQ-----------------------
1mivA2          ----------------------------------------------------------------------
1mivA1          ----------------------------------------------------------------------
1vfgA1          ----------------------------------------------------------------------
2hekA1          KLAGLLHDLGHPPFSHTTEVLLPRERSHEDFTERVIK---------------------------------
1vfgA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLS
1ou5A2          ----------------------------------------------------------------------
1ou5A1          ----------------------------------------------------------------------
1mivA2          ----------------------------------------------------------------------
1mivA1          --------------------------------------------------------------------VN
1vfgA1          ----------------------------------------------------------------------
2hekA1          ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GAALLELGIPEGPEVGLILEKLCEEQVTGSITDTKTALLxxxxxxxxxxxxx
1ou5A2          ----------------------------------------------------
1ou5A1          ----------------------------------------------------
1mivA2          ----------------------------------------------------
1mivA1          GKDVIEVGKPAGPWVKEALDAIWRAVVNGEVENEKERIY-------------
1vfgA1          ----------------------------------------------------
2hekA1          ----------------------------------------------------
1vfgA2          ----------------------------------------------------