[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO48823.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d7rA.bssp"
#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1f1rA2.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "2gmqA1.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "2j85A1.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1pixA3.bssp"
#ERROR : Can't open dsspfile "1aupA2.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1yd9A1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1c4kA2.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "2i7nA1.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"

## Summary of PDB Search
:396
    e-100  33%  1d7rA  [c.67.1.4] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    9e-86  33%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    9e-85  34%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    2e-71  20%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-65  37%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    9e-59  24%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    7e-55  28%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    6e-48  12%  1c7nA  [c.67.1.3] CYSTALYSIN
    9e-48  20%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    4e-45  13%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    2e-44  13%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    2e-44  16%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    1e-43  14%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-41  12%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    4e-41  11%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    1e-40  13%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    2e-40  14%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-40  14%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    2e-39  19%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    3e-39  10%  1d2fA  [c.67.1.3] MALY PROTEIN
    9e-39  10%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    4e-38  10%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    7e-38  15%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    1e-36  15%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    1e-36  13%  1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
    4e-34  14%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    7e-33  14%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    1e-32  11%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-32  12%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    5e-32  16%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    7e-29  14%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    7e-28  14%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    8e-28  11%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    8e-25  14%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    3e-24  23%  2gmqA1 [b.122.1.11] HYPOTHETICAL PROTEIN EF0006 A:12 -- 113
    3e-23  12%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    2e-22  15%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    1e-20  13%  2j85A1 [d.321.1.1] STIV B116 A:2 -- 116
    2e-20  16%  1qz9A  [c.67.1.3] KYNURENINASE
    1e-18   8%  1pixA3 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:288 --
    2e-17  13%  1aupA2 [c.58.1.1] NAD-SPECIFIC GLUTAMATE DEHYDROGENASE A:1 -- 192
    5e-17  23%  1bs0A  [c.67.1.4] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    6e-16   5%  1c8nA  [b.121.4.7] COAT PROTEIN
    3e-15  12%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    2e-12  14%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    9e-12   8%  1yd9A1 [c.50.1.2] CORE HISTONE MACRO-H2A.1 A:6 -- 193
    2e-11  10%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    4e-10  15%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    6e-08  16%  1c4kA2 [c.67.1.5] PROTEIN (ORNITHINE DECARBOXYLASE) A:108 -- 569
    2e-07  11%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    8e-07  16%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    1e-06  21%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    3e-06  19%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    4e-06   6%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    7e-06   8%  2i7nA1 [c.55.1.14] PANTOTHENATE KINASE 1 A:236 -- 381
    2e-04  15%  1bj4A  [c.67.1.4] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-04  10%  1ei7A  [a.24.5.1] COAT PROTEIN
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
1d7rA           -----------QHLVRYGGTFPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
1sf2A           -SNKELMQRRSQAIPRGVGQHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKK
1gbnA           --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK
1ohvA           PRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNV
1vefA1          ---RALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET
1dtyA           --TTDDLAFDERHIWMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
2cfbA1          ---------------------PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEK
1c7nA           ----------------IYDFTTKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVADNPPELIEGLKKYLDE
1ax4A           ----------------------------------------------------------------------
2bwnA1          --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
1u08A           --------------LIPQSKLPQLGTTIFTQMSALAQQHQAINLSQG---FPDFDGPRYLQERLAHHVAQ
1fc4A           -------------------KEERIITSAQQADITVADGSHVINFCANNY--LGLANHPDLIAAAKAGXDS
1lc5A           ---------------------AHGGNIREPATVLGISPDQLLDFSANINP---LGMPVSVKRALIDNLDC
2gb3A1          ---------------------SPIRKLVPFAEXAKKRGVRIHHLNIGQPD---LKTPEVFFERIYENKPE
1pmmA           ----------------AESKRFPLHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
1b8gA           -------------------------EYEKNPYHEVHNTNGIIQMGLALESWLAKNPEAAAFKKNGESIFA
1b5oA           ---------------------SATVAVNAKALELRRQGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
1c0nA           ---------------------VDAVRADFPVLSREVNGLPLAYLDSAA----SAQKPSQVIDAEAEFYRH
1wytB1          --------------------------VDELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAAR
1d2fA           -----------------------------------------LPFTISDMD---FATAPCIIEALNQRLMH
1bw0A           --------------------------------------------VGDPTLDKNLLTSAAQIKKLKEAIDS
3bc8A1          --------------LLEQGKCPED-GWDESTLELFLHELAVMDSNNFLGNCGVGEREGRVASALVARRHY
1ecxA           --------------------------------------RVYFDNNA------TTRVDDRVLEEMIVFYRE
1iugA           ----------------------------------------WLLTPGP------VRLHPKALEALARP---
1f1rA2          ----------------------------------------------------------------------
1agxA           ------------YSAAKVPVDALIKAVPQVNDLANITGIQALQVASESIT---DKELLSLARQVNDLVKK
1v72A1          ----------------------------------------ALGF----SSDNIAGASPEVAQALVKHSSG
1h1cA           --------------------------------PYETEKRDKTYLALNENP---FPFPEDLVDEVFRRLNS
1b9hA           -----------------------------------------------------FPAWPQYDDAERNGLVR
1m32A           ----------------------------------------YLLLTPGPL-----TTSRTVKEAXLFDSCT
1mdoA           ----------------------------------------------------LPFSRPAXGAEELAAVKT
1h0cA           ----------------------------------------LLKPLSIPNQLLLGNLPPRIMAAGGLQMIG
1vp4A           ----------------------------------------------------LQYSTTEGDPVLKQQILK
2fn6A1          ----------------------------------------------------FAYSEPCLDKEDKKAVLE
2gmqA1          -------------------------------------------------------------KEIAIQEKD
1vk9A           ----------------------------------------------------------------------
1jg8A           ------------------------------------------------------KPTEEMRKAMAQAEVG
2j85A1          ----------------------------------------------------------------------
1qz9A           ----------------------------------------------------------------------
1pixA3          ----------------------------------------------------------------------
1aupA2          ---------------------------------------KYVDVIAEVEKKYA--DEPEFVQTVEEVLSS
1bs0A           -------------------RYPVA--QGAGRWL-VADDRQYLNFSSN---DYLGLSHPQIIRAWQQGAEQ
1c8nA           ----------------------------------------------------------------------
1aamA           ------------------------------DLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLET
1cs1A           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
1c4kA2          ----------------------------------------------------------------------
1cl1A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
2aeuA1          ----------------------------------------------------------------------
1svvA           --------------------------------------------------------HPKILDLX---ARD
1xl7A1          ----------------------------------------------------------------------
2i7nA1          ----------------------------------------------------------------------
1bj4A           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
1d7rA           LDHLFSGMLSRPVVDLATRLANITPPDRALLLSTGAESNEAAIRMAKLV------TGKYEIVGFAQSWHG
1sf2A           LSHCFQVLAYEPYLELCEIMNQGDFAKKTLLVTTGSEAVENAVKIARAA------TKRSGTIAFSGAYHG
1gbnA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGKYKAKIVFAAGNFWG
1ohvA           STFINILPPENFVEKLRESLLSPKGMSQLITMACGSCSNENAFKTIFMWINQAPGCPDYSILSFMGAFHG
1vefA1          LMAMPQTLPTPMRGEFYRTLTAPPELNRVFPVNSGTEANEAALKFARAH------TGRKKFVAAMRGFSG
1dtyA           MHVMFGEITHAPAIELCRKLVAPQPLECVFLADSGSVAVEVAMKMALQYWDAKGEARDRFLTFR-NGYHG
2cfbA1          --GTSFGAPCLLENILAEMVIAAPSVEMVRFVNSGTEACMAVLRLMRAY------TQREKVIKFEGCYHG
1c7nA           TVLGYTGPTEEYKKTVKKWMKDRHQWDWIINTAGVVPAVFNAVREFTKP--------GDGVIIITPVYYP
1ax4A           --------------DLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFIS--NFHFD
2bwnA1          VGAGSGGTRTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYS-------DSLNHA
1u08A           GANQYAPMTGVQALRIAQKTERLYGDSDITVTAGATEALYAAITALVRNGDEVICFD--------PSYDS
1fc4A           HGFGXASVRFICGTELEQKLAAFLGXEDAILYSSCFDANGGLFETLLGA---------EDAIISDALNHA
1lc5A           IERYPDADYFHLHQALARHH--QVPASWILAGNGETESIFTVASGLK----------PRRAMIVTPGFAE
2gb3A1          VVYYSHSAGIWEASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLE--------PFYAN
1pmmA           NWIDKEEYPQSAAIMVADLWHAKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP
1b8gA           ELALFQDYHGLPAFKMAEIRKVTFDPNHLVLTAGATSANETFIFCLADP--------GEAVLIPTPYYPG
1b5oA           GKTKYAPPAGIPELRFRRENGLSVTPEETIVTVGGSQALFNLFQAILDP---------GDEVIVLSPYWV
1c0nA           GYAAVHAGATEKMENVRKRASLFINARSAEELVFVRGTTE-GINLVANSWGNSNVRAGDNIIISQMEHHA
1wytB1          LFADLHPYQDPRTAELGEYLKALTGMDAITEPAAGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHG
1d2fA           GVFGYSRWKNDEAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGE---------GVVIHTPAYD
1bw0A           QECFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVSGGSHGILMAITAICDAGDYALVPQPGFPH
3bc8A1          RFIHGIGLLNKITNSLVLNVIKVHSVASCFVVPMATGMSLTLCFLTLRHKRPK-----AKYIIWPRIDQK
1ecxA           KYHGMGIEANLHMEKAREKVAKGVSPSEIFFTSCATESINWILKTVAETFE-----KRKRTIITTPIEHK
1iugA           QLHHRTEAAREVFLKARGLLRERTEGEVLILTGSGTLAMEALVKNLFAPGERVLVPVYG--------KFS
1f1rA2          ----------------------------------------------------------------------
1agxA           PSVNGVVITHDTMEETAFFLNLGSMRPSTALSADGPLNLYSAVALASSNEA----KNKGVMVLMNDSIFA
1v72A1          QAG--PYGTDELTAQVKRKFCEIFERDVEFLVPTGTAANALCLSAMTPPWGNIYCHPASH-------INN
1h1cA           DAL--RIYYDSPDEELIEKILSYLDTDFLSKNNVSVGNGADEIIYVXXLXFDR-------SVFFPPTYSC
1b9hA           ALEQGQWWRMGGDESFEREFAAHHGAAHALAVTNGTHALELALQVMGVG--------PGTEVIVPAFTFI
1m32A           WDDDYNIGVVEQIRQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGP--------QDKVLIVSNGAYG
1mdoA           VLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGXHIALXALGIGEGDE--------VITPSXTWV
1h0cA           SMSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALVNVLEPGDSFLVGA--------NGIWG
1vp4A           LLERXYGITGLD-------------EDNLIFTVGSQQALDLIGKLFLDD---------ESYCVLDDPAYL
2fn6A1          VLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNFSEFSADR-----NEIITTPISFV-
2gmqA1          LTL----QWRGNTGKLVKVRLKNTRAXEXWYNKQITEENIQEI------------------TTLNIIKNG
1vk9A           ----------------------------------------------------------------------
1jg8A           ----DDVYGEDPTINLERLAAETFGKEAALFVPSGTMGNQVSIMA-------HTQRGDEVILEADSHIFW
2j85A1          ----------------------------------------------------------------------
1qz9A           -------------------------DGEVVVTDTTSINLFKVLSAALRV-QATRSPER-RVIVTETSNFP
1pixA3          ----------------------------------------------------------------------
1aupA2          LGPVVDAHPEYEEVALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQ---------------------
1bs0A           FGHVSGYSVVHQALELAEWLG----YSRALLFISGFAANQAVI--AAMMAKEDR------IAADRLSHAS
1c8nA           -----------------------------TPIALAYTVQSLPLIA--------TQPA--WLGTIADNYSK
1aamA           TKNYLGIDGIPEFGRCTQELLFNDKRARTAQTPGGTGALRVAADFLAKNTSVK------RVWVSNPSWPN
1cs1A           ----------------------------AVLTNTGMSAIHLVTTV-------FLKPGD-LLVAPHDCYGG
1yd9A1          -----------------------------AVVHPTNTDFYIGGEVGSTLEKKGGKEFVEAVLELRKKNGP
1s2bA           ----------------------------------------------------------------------
2e7iA1          --------------QLPKFL----GCDVARVTNGAREAKFAVMHSLAK---------KDAWVVMDENCHY
1c4kA2          -------------------------ADKTYFVGGSSNANNTVT--------SALVSNGDLVLFDRNNHKS
1cl1A           ---------------LQQAMCELEGGAGCVLFPCGAAAVANSI---------LAFIEQGDHVLMTNTAYE
1elqA           ---------------LAETF--NVDPNTITITDNVTTGCDIVLWGLDWHQGDEI------LLTDCE--HP
2aeuA1          --------------------------------SGGFLIDEKDKALLNTYGLKHLGGDENDKCVGFNRTSS
1svvA           NXTQHAGYHCAKAARLIGELLERPDAD-VHFISGGTQTNLIACSLALR------PWE--AVIATQLGIST
1xl7A1          ----------------------------------------------------------------------
2i7nA1          ----------------------------------------------------------------------
1bj4A           ---------------------DPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLD---LPDGGHLTHG
1ei7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
1d7rA           MTGAAASATGVGPAAVGSFAIPAPFTYRPLAELDYAFDLIDRQSAAFIAEPILSSGGIIELPDGYMAALK
1sf2A           RTHYTLALTGKVNPYSGMGLMPGHVYRALYDAIASINDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLR
1gbnA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNAAFMVEPIQGEAGVVVPDPGYLMGVR
1ohvA           RTMGCLATTHSKAIHKIDIPSFDWPIAPFPRDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLR
1vefA1          RTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAR
1dtyA           DTFGAMSVCDPDNSMHSLWKGYLPENLFAMVGFARLMAAHRHEIAAVIIPIVQGAGGMRMYHPEWLKRIR
2cfbA1          HA------------------ATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLR
1c7nA           FFMAIKNQERKIIECELLEKDGYY-----TIDFQKLEKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIK
1ax4A           TTAAHVELNGCKAINIVTEKAFDSETYDDWKDIKKLKENIAQHIVAIVSTVTCNSAGGQPVSMSNLKEVY
2bwnA1          SMIEGIKRNAGPKRIFRHND--------VAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
1u08A           YAPAIALSGGIVKR-------MALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVW-QQADFAALW
1fc4A           SIIDGVRLCKAKRYR---------YANNDXQELEALKEAAGARHVLIATDGVFSXDGVIA----NLKGVC
1lc5A           YGRALAQSGCEIRRWS-------LREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLP-ERPLLQAIA
2gb3A1          YNAFAKIAGVKLIPVTR-------RXEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDEXRYLV
1pmmA           VQICWHKFARYWDVELREIPMRPGQ---LFMDPKRMIEACDENTIGVVPTFGVTYTGNYPQPLHDALDKF
1b8gA           FDRDLKWRTGVEIVPIHCTSSNGFITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTR-NELYLLL
1b5oA           SYPEMVRFAGGVVVEVETLPEEGFVP-----DPERVRRAITPRTKALVVNSPNNPTGAVYPKE-VLEALA
1c0nA           NIVPWQMLCARVGAELRVIPLNPDGTL----QLETLPTLFDAATRLLAITHVSNVLGTEN----PLAEMI
1wytB1          SNPATASMAGY-------QVREIPSGPEGEVDLEALKRELGPHVAALMLTNPNTLGLFER----RILEIS
1d2fA           AFYKAIEGNQRTVMPVALEKQADGW----FCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMA
1bw0A           YETVCKAYGIGMH------FYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSR-KHVEDIV
3bc8A1          SCFKSMVTAGFEPVVIENVLEGDELRT----DLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELA
1ecxA           AVLETMKYLSMKGFKVKYVPVDSRGVV----KLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVK
1iugA           ERFYEIALEAGLVVERLDYP---------YGDTPRPEDVAKEGYAGLLLVHSETSTGALADLPALARAFK
1f1rA2          -------------LEDLGFRVSEDIKDSDGVTYAAWMHRKQTVHDTALTGGNGPRMHHVAFATHEKHNII
1agxA           ARDVTKGINIHTHAFRSSVKKHTNNSEFNNMMPDAYQAFAKAGVKAI----IHAGTGNGSMANYLVPEVR
1v72A1          DECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVGDVHTTQPACVSITQATEVGSIYTLDEIEAIG
1h1cA           YRIFAKAVGAKFLEVP-------------LTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIER---
1b9hA           SSSQAAQRLGAVTVPVDVD------AATYNLDPEAVAAAVTPRTKVIM-------PVHMAGLMADMDALA
1m32A           ARXV------EXAGLXGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAXVHSET--TTGXLNPIDEVG
1mdoA           STLNXIVLLGANPVXVDVDRDT------LXVTPEHIE-------AAITPQTKAIIPVHYAGAPADLDAIY
1h0cA           QRAVDIGERIGVHPMT-------KDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGV----LQPLDGFG
1vp4A           GAINAFRQYLANFVVVPLEDDGXDLNVLERKLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALV
2fn6A1          -------ATANMLLESGYTPVFAGIKNDGNIDELALEKLINERTKAIVSVDYAG-------KSVEVESVQ
2gmqA1          KSLALEVYPEKSIYVKPRINVPVFFIKTPINRGVFE----------------------------------
1vk9A           ----------------GSDKIHHHHHHVEKNLLRSALKIFEKKDLAYSGRSIFESKDSGL---KPVVELF
1jg8A           YEVGAMAVLSGVMPHP----VPGKNGAMDPDDVRKARNIHFPRTSLIAIENTHNRSGGRVVPLENIKEIC
2j85A1          ----------------------------------------------------------------------
1qz9A           TDLYIAEG--------LADMLQQGYTLRLVDSPEELPQAIDQDTAVVMLTHVNYKTGYMH----DMQALT
1pixA3          ------------------------------------------YPEYKAAGSVGIGGKLYRQGLVKMNEFV
1aupA2          -------------FNGAIGPYLGGLRFAPSVNLSIMKFLGFEQASLTTLPMGGAKGGSDFDPNGKSDREV
1bs0A           LLEAASLSPSQLRRFAHNDV----------THLARLLASPCPGQQMVVTEGVFSMDGDS----APLAEIQ
1c8nA           WRWVSLRIIY---SPKCPTTTSGTVAM----CLSYDRNDVAPGSRVQLSQTYKAINFPPYAG-YDGAAIL
1aamA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLA-
1cs1A           SYRLFDSLAKRGCYR---------VLFVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICH---
1yd9A1          ------LEVAGAAVSAGHGLPAKFVIHCNSKTVKNCLALADDRKLKSIAFPSIGSGRNGFAAQLILKAIS
1s2bA           -----------------------SITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKS--FSNESSG
2e7iA1          SSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITYPDGN----YGNLPDVKKIA
1c4kA2          VYNSALAMAGGRPVYLQTNRNPYGFIGIYDSDFDEKKIRELAAKVAKWKRPFRLAVIQLGTYDGTIHEVV
1cl1A           PSQDFCSKILSKLGVTTSWFDP--------LIGADIVKHLQPNTKIVFLESPGSITMEVH----DVPAIV
1elqA           GIIAIVQAIAA-RFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCR
2aeuA1          AILATILAPGHPSIERSCKIV--NAKYFESDKVGEILNKIDKDT-LVIITGSTMDLKVIELEN--FKKVI
1svvA           HETGAIEATGHKVV---TAPCPDGKL-----RVADIESALHENRPKLVISNTTEVGTQYTKQ--ELEDIS
1xl7A1          -------------------------------NIAHYVDERVLETEGRWKGSEKVRDIPLPE-------EL
2i7nA1          ----------------------------------------------------------------------
1bj4A           FMTDKKKISATSIFESMPYKVNPDTGYI---NYDQLEENARLFHPKLIIAGTSCYSRNLEYAR-----LR
1ei7A           -------------------------------LVTALLGAFDTRNRIIEVENQANPTAETLDATRRVDDAT


                         .         .         .         +         .         .         .:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
1d7rA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHEYLFYT
1sf2A           ALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG
1gbnA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALGGLYPVSAVLCDDDIMLTIKPGEHGS
1ohvA           DISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGGFFHKE-----EFRPNAPYRIFN
1vefA1          EITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGT
1dtyA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGTMTLSATLTTREVAETISDGMHGP
2cfbA1          ELTKQYGALLVFDEVMTG-FRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEI--MKMVAPAGP
1c7nA           DIVLKSDLMLWSDEIHFDLIMPGYEIDEQLADKTITFTAPSKTFNIGMGMSNIIIKNPDIRERTKSRDAT
1ax4A           EIAKQHGIFVVMDSARFCKARDPKYKNATIKEVIFDMYKYADALDPLLNIGGLVAIRDNEEIFTPMEGFV
2bwnA1          DIAEEFGALTYIDEVHAGMYGPRGAGVAERDGLMHRIDIFNGTLAXAYGVFGGYIAASADAVRSYAPGFI
1u08A           QAIAGHEIFVISDEVYEHINFSQQGHASQLRERAVAVSSFGKTYHTGWKVGYCVAPAPISAEIRKVHQYL
1fc4A           DLADKYDALVXVDDSHAVGFGENGRGSHEYCDVXGRVDIITGTLGGGASGGYTAARKEVVEWLRQRSRPY
1lc5A           DRCKSLNINLILDEAFIDFIPHETGFILKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQM
2gb3A1          EIAERHGLFLIVDEVYSEIVFRGEFASAL--SIESDKVVVIDSVSCGARVGCLITRNEELISHAXKLAQG
1pmmA           QADTGIDIDMHIDAASGGFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEGGQIGTFAINFS
1b8gA           SFVEDKGIHLISDEIYSGTAFSSPSFISEVWQRVHVVYSLSKDLGPGFRVGAIYSNDDMVVAAATKMSSF
1b5oA           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQS
1c0nA           TLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKEALLQEMPPWEGGGSMIA
1wytB1          RLCKEAGVQLYYDGANMGWARPGKTFTVPHGGGGPGKAHLAPYLPVPLVERGEEGFYLDFDRPKSIGRVR
1d2fA           DLCERHGVRVISDEIHMDMVWGEQPWSNVARGDWALLTSGSKSFNPALTGAYGIIENSSSRDALSALKGR
1bw0A           RLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPNLVVPGWRLGWLLYVDPHGNGPSFLEGML
3bc8A1          VICANYDIPHVVNNAYGLQSSKCMHLIQQGARGRIDAFVQSLDXNFMVPVGIAGFNEPFIQDISKMYPGR
1ecxA           --KKNKETLVHVDAVQTIGKIPFSLE---KLEVDYASFSAHKFHGPGVGITYIRKGVPIRPLIHGGGRSG
1iugA           --EKNPEGLVGADMVTSLLVGEVALE---AMGVDAAASGSQXGLMCPPGLGFVALSPRALERLKPRGYYL
1f1rA2          QICDKMGALRISDRIERGPGRHGVSNAFYLYILDPDGHRIEIYTQDYYTGDPDNPTITW---DVHDNQRR
1agxA           KLHDEQGLQIRSSRVAQGFVLRNAEQPDDKGWIAAHDLNPQKARLMALALTKTNDAKEIQNMFWN-----
1v72A1          DVCKSSSLGLHMDGSRFANALVSLGCSPMTWKAGVDALSFGATKNVLAAEAIVLFNTSLATEMRRKRAGH
1h1cA           --ILKTGAFVALDEAYYEFHGESYVDFLKKYENLAVIRTFSKAFSAAQRVGYVVASE--KFIDAYNRVRL
1b9hA           KISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHS
1m32A           ALAHRYGKTYIVDAXSSFGGIPXDI---AALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSL
1mdoA           ALGERYGIPVIEDAAHAT-GTSYKGRHIGARGTAIFSFHAIKNITCAEGGIVVTDNPQFADKLRSLAPGY
1h0cA           ELCHRYKCLLLVDSVASLGGTPLY---MDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKP
1vp4A           EIAEKYDLFIVEDDPYGALRYEGEIFKIGGPERVVLLNTFSKVLAPGLRIGXVAGSKEFIRKIVQAKQSA
2fn6A1          KLCKKHSLSFLSDSSHALGSEYQNKKVGGFALASVFSFHAIKPITTAEGGAVVTNDSELHEKMKLKSIGH
2gmqA1          ----------------------------------------------------------------------
1vk9A           KRFDNLEGSLVIDKXVGK-AAASFLLKXKPDHIHAKVISPALKLXNEYGQSFSYDEKIPFVLGKDGKSXC
1jg8A           TIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSXGLCAPVGSVVVGDRDFIERARKARKM
2j85A1          ----------------------------------------------------------------KVFLTN
1qz9A           ALSHECGALAIWDLAHSAGAVPVDL---HQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPLSGW
1pixA3          TLCARDRLPIVWIQDTTELLGLGQSLIYSIQTSHIPQFEIRKGTAAAHYVLGGPQGNDTNAFSIGTAATE
1aupA2          MRFCQAFMTELYRHIGPDIDVPAGDLGAREIGYMYGQY--RKIVGGFYN---------------------
1bs0A           QVTQQHNGWLMVDDAHTGIGEQGRGSCW-LQKVKPELLTFGKGFGVS--GAAVLCSSTVADYLLQFARHL
1c8nA           NTDVTPTSAIYVDVDVTRFDKAWYSTIGALTAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKYVIELIEP
1aamA           QLSVEKGWLPLFDFAYQGFARGLERAFAAMHKELIVASSYSKNFLYNERVGACTLVAADSETVDRYSNPP
1cs1A           -LAREVGAVSVVDNTFL----SPALQNPLALGADLVLHSCLNGHSDVVAGVVIAKDPDVVTELAWWANNI
1yd9A1          SYFVSTMSSSIKTVYFVLFDS-------------------------------------------------
1s2bA           SLCRTNAEFIIEDFEECNSNGSDCEFSPAVEFTDCSVTSDGESVSDDAQITQVIINNQDVTD--------
2e7iA1          KVCSEYDVPLLVNGAYAIGRMPVSL---KEIGADFIVGSGHKSMAASGPIGVMGMKEEWARSEKYKNKEV
1c4kA2          KRIGHLCDYIEFDSAWVGYEQFIPMLLIDDLGPEDIIVVQVHKQQAGFSQTSQIHKSHIKGQLRYCDFMS
1cl1A           AAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATXYLVGHSDAMIGTAVCNARCWEQLRENAYLM
1elqA           RHQGNYPVRVLVDGAQ-SAGS--LPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPGWRSI
2aeuA1          NTAKNKEAIVFVDDA-SGARVRLLFNQPPALKLGADLVSTDKLMEG--PRGGLLAKELVDKIYIEG-TKF
1svvA           ASCKEHGLYLFLDGARLALSSPVNDLTLADIARLTDXFYIGATKAGGXFGEALI----------------
1xl7A1          VFTVDEKILNDVSQAKAQHL--------------------------------------------------
2i7nA1          --------WFGMDIGGT----LVKLVYFEPKDLKSIRKYLSNTAYGKTGIRDVHLELKNLTMRKGNLHFI
1bj4A           KIADENGAYLMADMAHSGLVAAGVVFEHCHVVTTTTHKTLRGCRAGGVKSVDPATGKEIESLINSAVFPG
1ei7A           VAIRSAINNLIVELIRGTGSYNRS----------------------------------------------


                         .         *         .         .         .         .         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI
1d7rA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRKI
1sf2A           TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRFEDGDHNKPDAKLTAEI
1gbnA           TYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVTAVRLNAIVIKETKDWDAWKV
1ohvA           TWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPFISRVRGTFCSFDTPDESIRNKL
1vefA1          TFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK-IREVRGMGLMVGLELKEKAAPYI
1dtyA           TFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA-RDAEMVADVRGAIGVVETTHPVNMAAL
2cfbA1          TLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGTNYEQAKQSDLKKFAAF
1c7nA           SGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLYLQWIDFRALKMDHKAM
1ax4A           TYGGLAGRDMAAMVQLEEGTEEEYLHYRIGQVKYLGDRL--REAGIPIQYPTG-----------------
2bwnA1          FSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMIDHGSHIVPVVIGDPVHTKAVS
1u08A           TFSVNTPAQ-LALADMLRAEPEHYLALPDFYRQKRDILVNAL-NESRLEILPCLLVDYSAVSTLDDVEFC
1fc4A           LFSNSLAPAIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAGADHAIIPVXLGDAVVAQKF
1lc5A           PWSVNALAALAGEVALQDSWQQATWHWLREEGARFYQAL----CQLPLLTVYPGRANYLLLRCEREDIDL
2gb3A1          RLAPPLLEQIGSVGLLNLDDSF--FDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPVEDAT
1pmmA           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDL
1b8gA           GLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLREL
1b5oA           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIVRA
1c0nA           AGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESDLTLYGPQARLGVIAFNLGAHHAYDV
1wytB1          SFYGNFLALVRAWAYIRTLGLEGLKKAAALAARYLKELLKEKGYR-VPYDGPSMHEFVAQPPEGFRALDL
1d2fA           DGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQYLAWLDLRPLNIDDNAL
1bw0A           VCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMY-LYNHIGECIGLAPTMPRGAMYLMSRIDLEEFF
3bc8A1          ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHH
1ecxA           TQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTL
1iugA           DLARELKAQKEGESAWTPAINAAVLEALKAWQNALLYGVGEEGGLRPVPKRFSPAVAAFYLPEGVPYARV
1f1rA2          DWWGNPVVPSWYTEASLVLDLDGNPQPV------------------------------------------
1agxA           ----------------------------------------------------------------------
1v72A1          LSSKMRFLSAQIDAYLTDDLW---LRNARKA----NAAAQRLAQGLEGLGGVELGGTEANILFCRLDSAM
1h1cA           PFNVSYVSQXFAKVALDHREIEERTKFIVEERERXKSALREXG-----YRITDSRGNFVFVFXEKEEKRL
1b9hA           CGRPRDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIALSRLLGAIDGVVMAMFRIPGLTEERRNAL
1m32A           SLDLYAQTVLAFAQALKELAKEGGVQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITAFYSPEDPQSEF
1mdoA           KYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAXADLPFQPLSLPSWEHIHAWHLFIIRVDEARCGI
1h0cA           HHTIPVISLYSLRESLALIAEQGLENSWRQHREAAA-YLHGRLQALGLQLFVKTVTTVAVPAGYDWRDIV
1vp4A           DLCSPAITHRLAARYLERYDLLEQLKLYRRKRTVXLNALEEYFSDIPGVKWVKSEGGLFIWLTLPEGFDK
2fn6A1          NFRLNEIQSALGLSQLKKA--PFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDKSSNHLYPILMHQKLI
2gmqA1          ----------------------------------------------------------------------
1vk9A           PFEKLVLEXDDPEEIIRIVLSK------------------------------------------------
1jg8A           LGGGGVLAAAGIIALTK---MVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGF
2j85A1          AFSINXLKEFPTTITIDKLDEEDFCLKLELRLEDG-----TLINAIGHDSTIN-LVNTLCGTQLQKNRVE
1qz9A           FGHSRQFMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRCAAHELTLVTPREHAKRGSHVSFEHPEV
1pixA3          IAVMNGETAATAMYSRRLAKDRKAGKDLQPTIDKMNNLIQAF-YTKSRPKVCAELGLVDEIVDMNKIRGY
1aupA2          ----------------------------------------------------------------------
1bs0A           IYSTPPAQAQALRASLAVIRSDERREKLAALITRFRAGVQDLPFT---LADSCSAIQPLIVGDNSRALQL
1c8nA           I---------------------------------------------------------------------
1aamA           AHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQ
1cs1A           GVTGGAFDSYLLLRGLRTLRMELAQRNAQAIVKYLQT---------------------------------
1yd9A1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
2e7iA1          ELLGRGATIITLMASFPHVRERKRWDEEVEKARRFAAEMEKLGIKAEVLYEISKKAKGGRFFLYRELKSR
1c4kA2          TSPFYPMYAAVNAAMQEGEAGRKLWHDLLITTIEARKKLIKA----------------------------
1cl1A           GQMVDADTAYITSRGLRTL---------------------------------------------------
1elqA           TYGAAYPQYAGLLAALQLHQRQGTAEERYQRSEFLWRGLNQLPHHCLATSAPQAGLVSFTVDSPLGHRAI
2aeuA1          GLEAQPPLLAGIYRALKNF---------------------------------------------------
1svvA           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
2i7nA1          RFPSCAMHRFIQMGCATGGGAFKDFLHKLDELDCLIQGLLYV----------------------------
1bj4A           LQGGPHNHAIAGVAVAQAMYQHQVVANCRALSEALTE---------------------------------
1ei7A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMxxx
1d7rA           TRECMNLGLSMNPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
1sf2A           VARARDKGLILLSCYYNVLRILVPLTIEDAQIRQGLEIISQCF---
1gbnA           CLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI---
1ohvA           ISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL---
1vefA1          ARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVR------
1dtyA           QKFFVEQGVWI-RPFGKLIYLMPPYIILPQQLQRLTAAVNRAV---
2cfbA1          HRGMLEQGIYL--APSQFEAGFTSLAHTEADIERTIAAARTVL---
1c7nA           EEFMIHKAQIFIFGDGGIGFERINLAAPSSVIQESLERLNKAL---
1ax4A           ----------------------------------------------
2bwnA1          DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDL-----
1u08A           QWLTQEHGVAACADPFPHKLIRLCFAKKESTLLAAAERLRQ-----
1fc4A           ARELQKEGIYVTPKGQARIRTQXSAAHTPEQITRAVEAFTRIG---
1lc5A           QRRLLTQCANYPGLDSRYYRV---AIRSAAQNERLLAALRNVL---
2gb3A1          DFNXDGETTXVAPLRGGKKEIRIACVLEKDLLSRAIDVLXEGL---
1pmmA           SERLRLRGWQVPATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
1b8gA           WKKIVYEGSSCHCTEPGWFR-VCFANLPERTLDLAMQRLKAFV---
1b5oA           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
1c0nA           GSFLDNYGIAVRYNVPAMCRASLAMYNTHEEVDRLVTGLQRIH---
1wytB1          AKGLLELGFHPPTVYKEALMVEPTETEAKETLEAFAEAMGALL---
1d2fA           QKALIEQEPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAI---
1bw0A           EKLLEEENVQVLPGTHAPGFTRLTTTRPVEVYREAVERIKAFC---
3bc8A1          DKMLFTRQVSGARAVCAYLNAAAAIGMKMQDVDLFIKRLDKC----
1ecxA           QNLLSGYGIYVSRIAQGAIRISLCKYNTEEEVDYFLKKIEEIL---
1iugA           KEAFAQRGAVIAPLKGKVFRLSLMGAYDRYEALGVAGMFREVL---
1f1rA2          ----------------------------------------------
1agxA           ----------------------------------------------
1v72A1          IDALLKAGFGFYHDGPNVVRFVTSFATTAEDVDHLLNQVRLA----
1h1cA           LEHLRTKNVAVRSF-REGVRI---TIGKREENDXILRELEV-----
1b9hA           VDRLVEAGLPAFIYRTDAFWELGAPDESVDAIARRCPNTDAIS---
1m32A           YRRLKEQGFVIYPGQSDCFRIGNIGEVYAADITALLTAIRTA----
1mdoA           TRDALXASLKTKGNSERICSLPLFPDXTESDFDRVITALHQI----
1h0cA           SYVIDHFDIEIMGTGKVLRIGLLGCNATRENVDRVTEALRAAL---
1vp4A           KVFYVPGRVFKVYDEPSPSXRLSFCLPPDEKIVEGIKRLREVV---
2fn6A1          LESLHKRGILAQVHYKPIISLPCHANLNLESVQNIAHSVLKT----
2gmqA1          ----------------------------------------------
1vk9A           ----------------------------------------------
1jg8A           IEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEK-----
2j85A1          VKXNEGDEALI---IXISQRLEEGKVLSDKEIKDXYRQGKISF---
1qz9A           IQALIDRGVIGDYREPRIMRFFTPLYTTFTEVWDAVQILGEIL---
1pixA3          VEAFTEPESICPFHQMILPRAIREFETFVKK---------------
1aupA2          ----------------------------------------------
1bs0A           AEKLRQQGCWVTAAGTARLRLTLTAAHEMQDIDRLLEVLHGN----
1c8nA           ----------------------------------------------
1aamA           VLRLREEF-GVYAVASGRVNVAG---MTPDNMAPLCEAIVAVL---
1cs1A           ----------------------------------------------
1yd9A1          ----------------------------------------------
1s2bA           ----------------------------------------------
2e7iA1          KIHGIKPGL------TRYFK-LSTYGLSDEEVDYVLNAFKEII---
1c4kA2          ----------------------------------------------
1cl1A           ----------------------------------------------
1elqA           VQKLEEQRIYLTIADPDCIRACCHYITDEEEINHLLARLA------
2aeuA1          ----------------------------------------------
1svvA           ----------------------------------------------
1xl7A1          ----------------------------------------------
2i7nA1          ----------------------------------------------
1bj4A           ----------------------------------------------
1ei7A           ----------------------------------------------