[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO48876.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7bA.bssp"

## Summary of PDB Search
:151
    7e-05  12%  1s7bA  [f.39.1.1] EMRE PROTEIN
:151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWLAILY
1s7bA           ----------------------------------------------------------------LWPSVG


                         .         .         *         .         .         .         .:140
query           MAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPE
1s7bA           TIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS


                         +         .         .         .         .         *         .:210
query           SGVKExxxxxx
1s7bA           RSTPH------