[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49033.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mt1.1.bssp"
#ERROR : Can't open dsspfile "1om0A.bssp"

## Summary of PDB Search
:153
    2e-43  55%  1mt1.1 [d.155.1.2] PYRUVOYL-DEPENDENT ARGININE DECARBOXYLASE BETA
    0.001  19%  1om0A  [c.1.8.5] XYLANASE INHIBITOR PROTEIN I
:153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxTPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPGSLVPTAYGYI
1mt1.1          ----PNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS-IXPPEAEIVPLPKLPXGALVPTAYGYI
1om0A           ---PGKPLHLTATVRCGYPPAAHVGRALATGIFERVH---VRTYESDKWCNQNLGWYPATRFYVTADDKS


                         .         .         *         .         .         .         .:140
query           VSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVE
1mt1.1          ISDVPGETISAAISVAIPKDKSCGLIXEYEGKCSKKEAEKTVREXAKIGFEXRGWELDRIESIAVEHTVE
1om0A           HQWVHPKNVYYGVAPVAQKKDNYGGIM-------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIGCALAAVPLWY
1mt1.1          KLGCAFAAAALWY
1om0A           -------------