[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49673.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1l0oA.bssp"
#ERROR : Can't open dsspfile "1b3qA3.bssp"
#ERROR : Can't open dsspfile "2c2aA2.bssp"
#ERROR : Can't open dsspfile "1f51A.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1gjvA2.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "1ea6A2.bssp"
#ERROR : Can't open dsspfile "1oanA1.bssp"
#ERROR : Can't open dsspfile "2c2aA1.bssp"
#ERROR : Can't open dsspfile "1wj5A.bssp"
#ERROR : Can't open dsspfile "1p97A.bssp"
#ERROR : Can't open dsspfile "1vpkA1.bssp"
#ERROR : Can't open dsspfile "1qr0A2.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "1joyA.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1y8nA2.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "1ll8A.bssp"
#ERROR : Can't open dsspfile "1oj5A.bssp"
#ERROR : Can't open dsspfile "1s66L.bssp"
#ERROR : Can't open dsspfile "2oolA2.bssp"
#ERROR : Can't open dsspfile "2fi0A1.bssp"
#ERROR : Can't open dsspfile "2veaA3.bssp"
#ERROR : Can't open dsspfile "1utuA1.bssp"
#ERROR : Can't open dsspfile "3c2wA3.bssp"
#ERROR : Can't open dsspfile "1ya7O1.bssp"
#ERROR : Can't open dsspfile "1pvgA2.bssp"
#ERROR : Can't open dsspfile "2ookA1.bssp"
#ERROR : Can't open dsspfile "1g0dA1.bssp"
#ERROR : Can't open dsspfile "1g28A.bssp"
#ERROR : Can't open dsspfile "1mkmA2.bssp"
#ERROR : Can't open dsspfile "1b62A2.bssp"
#ERROR : Can't open dsspfile "1f5mA.bssp"
#ERROR : Can't open dsspfile "1tfoA1.bssp"
#ERROR : Can't open dsspfile "1rktA2.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"

## Summary of PDB Search
:578
    6e-25  19%  1id0A  [d.122.1.3] PHOQ HISTIDINE KINASE
    6e-24  27%  1bxdA  [d.122.1.3] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    1e-22  17%  1l0oA  [d.122.1.3] ANTI-SIGMA F FACTOR
    1e-21  20%  1b3qA3 [d.122.1.3] PROTEIN (CHEMOTAXIS PROTEIN CHEA) A:355 -- 539
    2e-20  30%  2c2aA2 [d.122.1.3] SENSOR HISTIDINE KINASE A:321 -- 481
    1e-19  12%  1f51A  [d.123.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE B
    2e-19  32%  1r62A  [d.122.1.3] NITROGEN REGULATION PROTEIN NR(II)
    8e-19  23%  1gjvA2 [d.122.1.4] [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE A:186 --
    1e-18  20%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    5e-18  17%  1aj6A  [d.122.1.2] GYRASE
    1e-17  17%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    5e-17  12%  1csgA  [a.26.1.2] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    7e-17  15%  1ea6A2 [d.122.1.2] PMS1 PROTEIN HOMOLOG 2 A:27 -- 231
    5e-16  13%  1oanA1 [b.1.18.4] ENVELOPE GLYCOPROTEIN A:298 -- 394
    1e-14  22%  2c2aA1 [a.30.2.1] SENSOR HISTIDINE KINASE A:232 -- 320
    4e-13  16%  1wj5A  [a.4.5.59] HYPOTHETICAL PROTEIN (RIKEN CDNA 0610009H20)
    5e-13   9%  1p97A  [d.110.3.7] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    5e-13  11%  1vpkA1 [d.131.1.1] DNA POLYMERASE III, BETA SUBUNIT A:1 -- 120
    5e-13  13%  1qr0A2 [d.150.1.1] 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP A:102 --
    6e-13  16%  1d06A  [d.110.3.2] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    2e-12  25%  1joyA  [a.30.2.1] PROTEIN (ENVZ_ECOLI)
    2e-12  20%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    3e-12  16%  1y8nA2 [d.122.1.4] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    2e-11  17%  1d7eA  [d.110.3.1] PHOTOACTIVE YELLOW PROTEIN
    3e-11  24%  1bywA  [d.110.3.6] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    1e-10  10%  1ll8A  [d.110.3.5] PAS KINASE
    6e-10   9%  1oj5A  [d.110.3.8] STEROID RECEPTOR COACTIVATOR 1A
    2e-09  26%  1s66L  [d.110.3.2] HYPOTHETICAL PROTEIN YDDU
    4e-09   6%  2oolA2 [d.110.3.9] SENSOR PROTEIN A:26 -- 139
    1e-08  12%  2fi0A1 [a.248.1.1] CONSERVED DOMAIN PROTEIN A:3 -- 81
    2e-08   7%  2veaA3 [d.110.3.9] PHYTOCHROME-LIKE PROTEIN CPH1 A:4 -- 130
    3e-08  16%  1utuA1 [a.283.1.1] EMSY A:11 -- 107
    7e-08   9%  3c2wA3 [d.110.3.9] BACTERIOPHYTOCHROME A:5 -- 117
    8e-08   7%  1ya7O1 [a.24.8.1] PROTEASOME ACTIVATOR PROTEIN PA26 O:4 -- 231
    1e-07  19%  1pvgA2 [d.122.1.2] DNA TOPOISOMERASE II A:7 -- 245
    2e-07   8%  2ookA1 [c.13.2.2] HYPOTHETICAL PROTEIN A:2 -- 126
    3e-07  11%  1g0dA1 [b.1.18.9] PROTEIN-GLUTAMINE GAMMA-GLUTAMYLTRANSFERASE A:6
    7e-07  20%  1g28A  [d.110.3.6] PHY3 PROTEIN
    2e-06  17%  1mkmA2 [d.110.2.2] ICLR TRANSCRIPTIONAL REGULATOR A:76 -- 246
    2e-06  28%  1b62A2 [d.122.1.2] PROTEIN (MUTL) A:1 -- 216
    1e-05  15%  1f5mA  [d.110.2.1] GAF
    5e-05   8%  1tfoA1 [d.243.1.1] COLICIN D A:595 -- 697
    1e-04   8%  1rktA2 [a.121.1.1] PROTEIN YFIR A:83 -- 205
    8e-04   9%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
:578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKS
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ookA1          ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1mkmA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1f5mA           -------------------------------------------------------------------KEE
1tfoA1          ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKDLINVPYAPGIGYAEHLAGNN
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ookA1          ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1mkmA2          ---NIRDIAHDHLVDI--MKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLLYSTASGKSEKELKEY
1b62A2          ----------------------------------------------------------------------
1f5mA           ILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGSEENTLILGPFQGKVACQMIQFGKG
1tfoA1          ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1vp4A           ----------------------KQVKFIYVVSNFHNPAGVTTS-LEKRKALVEIAEKYDLVEDDPYGALR


                         +         .         .         .         .         *         .:210
query           GIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGDIIAVLGVFMPCGMESPYTFSLTVAATKAVE
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ookA1          ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1mkmA2          LKIVELKPKTPNTITNPRVLKRELEKIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKA
1b62A2          ----------------------------------------------------------------------
1f5mA           VCGTAASTKETQIVPDVNHIACDGETKSEIVVPIISNDGKTLGVIDID----------------------
1tfoA1          ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1vp4A           YEGETVDPIFKIGGPERVVLLNTFSKVLAPGLRIVAGSKEFIRKIVQAK-----QSADLCSPAITHRLAA


                         .         .         .         +         .         .         .:280
query           AAIKQGQMEKQLQDTRKTLRNLMQQRNIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1p97A           -------------------------------DSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAY
1vpkA1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1d06A           ------ETEDVVRARDAHLRS-------ILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLR
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1d7eA           -------VAFGSEDIENTLAKMDDG---QLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFF
1bywA           ---------------------------------SRKFIIANENCAVIYCNDGFCELCGYSRAEVMQRPCT
1ll8A           ----------------------------MDPEFNKAIFTVDAKTEILVANDKACGLLGYSSQDLIGQKLT
1oj5A           ----------------------------------SFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCI
1s66L           ---------------------------IFFPALEQGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNID
2oolA2          -----------------ECDREPIHIPGAIQPHGYLFVVSETDLRIASVSANVEDLLRQPPASLLNVPIA
2fi0A1          ---------------------VVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVS
2veaA3          ----------LSDQSLRQLETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDLLGRTLG
1utuA1          ----------------------------------------------------------------------
3c2wA3          -----------------TLANCEDEPVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
1ya7O1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ookA1          ---------------------------------SVFFVTLKAIGTLTHEDYLVTPXLEGALSQVDQPKVS
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------KSFVITDPDNPIIFASDRFLELTEYTREEVLGNNFL
1mkmA2          EEI-------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1tfoA1          ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1vp4A           RYLERYDLLEQLKPTIELYRRKRTV---------------------------------------------


                         .         *         .         .         .         .         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEA
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           -------------------------------------------------------------------DTA
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           -----------------------------------------RRLLNLSRDTAAEMNETVEVISEMFDLQE
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          -------------------------------------------------------------MENVTESKE
1wj5A           ----------------------------------------------------------------------
1p97A           EFYHALDSENMTQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRLQPQCIMCVNYVLSEIE----
1vpkA1          ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1d06A           ILYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRSTFPMKLAVGEMRSGG--ERFFTGFIRDLT-------
1joyA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
1d7eA           KDTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMK---------------------------
1bywA           CDFLHRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVME------
1ll8A           QFDVVEALSEEHMEADGHAAVVFGTVVDIISRSEKIPVSVWMKRMRQERRLC---CVVVLEPVE------
1oj5A           YAREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIHIIDRE---------
1s66L           MLRDLRPAHPEYIRHNREGGK-ARVEGMSRELQSKIWTRFALSKVSAEGKVY--YLALVRDAS-------
2oolA2          ----------------------------------------------------------------------
2fi0A1          LK--------------------------------------------------------------------
2veaA3          EVAGQISSLNPSKLWARVMDFVIFDGVF--HRNSDGLLVCELEPAYTSDN--------------------
1utuA1          --------------------------------------LEAYAGVISALRAQGDLTKEKKDLLGELSSTE
3c2wA3          QVGPEVLRM--LEEGLTGNGPWGEHLFDVIGHSYKEVFYLEFEIRTAD----------------------
1ya7O1          ---------------------------------------------------------------FAVIEEW
1pvgA2          ----------------------------------------------------------------------
2ookA1          LFLDAGWDLRAAWDDLKLGLKHKSFERVAIL---GNKDWQEWAAKIGSWFIAGEIKYFEDEDDA------
1g0dA1          ------------------------------------SITLQCSDSLPPKHH----LELVLHLGKRDEVVI
1g28A           QGRGTDRKAVQLIRAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM--------
1mkmA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1tfoA1          ---------------------------------VYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYL-
1rktA2          ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
1id0A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1b3qA3          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1f51A           LTNELI------HLLGHSRHDWMNKLQLIKGNL--------------------SLQKYDRVFEMIEEMVI
1r62A           ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1csgA           PTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETS--CATQIITFESFKENLKDFLLVIPF
1ea6A2          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
2c2aA1          LERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSLKEFLEVIIDQSNHLENLLNELLD
1wj5A           --------------------------------------------------NLDLAGLTSLLSEKIKEFLQ
1p97A           ----------------------------------------------------------------------
1vpkA1          -------------------------------------------------------KVTVTTLELKDKITI
1qr0A2          ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1joyA           --GVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQ-------DGYLAESINKDIEECNAIIEQFID
1bknA2          ----------------------------------------------------------------------
1y8nA2          --------------------------------------------------------VHPKHIGSIDPTCN
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          RHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRL--------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          AAGTLQEIEGIAKAAAEA-----HGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIA
1pvgA2          ----------------------------------------------------------------------
2ookA1          ----------------------------------------------------------------------
1g0dA1          KVQKEHGARDKWGAQDEILLTLHSPANAVIGHYRLAVLVMSPDGH--IVERADKIS--------------
1g28A           ----------------------------------------------------------------------
1mkmA2          ----------------------------------------------------------------------
1b62A2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1tfoA1          ----------------------------------------------------------------------
1rktA2          --------------WASISSYLDELTEGLRDVADTLAPLVTAWRNERQYLEKRYDLFVERFSRLLQKGID
1vp4A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
1id0A           ---------ELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
1bxdA           -----EMPMEMADLNAVLGEVIAAESGYE----REIETALPGSIEVKMHPLSIKRAVANMVVNAARYGNG
1l0oA           -------------MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIIHGYN
1b3qA3          -------------ISFVFNRFPRMVRDLAKKMNKEVNFIMEDTELDRTFVEEIGEPLLHLLRNAIDHGIE
2c2aA2          -------NREKVDLCDLVESAVNAIKEFASSHNVNVLFNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKK
1f51A           DAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESE
1r62A           ---------VTESIHKVAERVVTLVSMELP-DNVRLIRDYPSLPELAHDPDQIEQVLLNIVRNALQALGP
1gjvA2          ----------------------------------------GNAPRVRINGHPLDYILPELLKNAMRATTP
1ys3A1          -------------------------------PDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA
1aj6A           ------------------------------LKGLDAVRKRGMYIGDTDDGTGLHHMVFEVVDNAIDEALA
1mu5A3          ------------------------------LSPAEFFKRNPELAGFPNPARALYQTVRELIENSLDATDV
1csgA           DCW-------------------------------------------------------------------
1ea6A2          -----------------------------------------------QVVLSLSTAVKELVENSLDAGAT
1oanA1          ----------------------------------------------------------------------
2c2aA1          FSR-------------------------------------------------------------------
1wj5A           EKKMQS-------FYQQELETVESLQSLA----SRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQE
1p97A           ----------------------------------------------------------------------
1vpkA1          ASKALAKKSVAGFLFEVKDGNFYICATDLETGVKATVNEISGEARFVVPGDVIQKMVKVLPDEITELSLE
1qr0A2          ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1joyA           YLR-------------------------------------------------------------------
1bknA2          --------------------------------------------------ERPASVVKELVENSLDAGAT
1y8nA2          VAD------VVKDAYETAKMLCEQYYLVAPELEVEEFNAKDKPIQVVYVPSHLFHMLFELFKNSMRATVE
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          IRIPEHKEEDNLGVA----------------------VQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIG
1pvgA2          ------------------------QEQLQWIYDEETDCXIEKNVTIVPGLFKIDEILVNAADNKVRD---
2ookA1          ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1mkmA2          ----------------------------------------------------------------------
1b62A2          ---------------------------------------------------RPASVVKELVENSLDA---
1f5mA           ----------------------------------------------------------------------
1tfoA1          ----------------------------------------------------------------------
1rktA2          QGEFQP----------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
1id0A           FVEISA----RQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGVGLAVAREITEQYEGKIVAGE
1bxdA           WIKVSSGTE----PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTGLGLAIVQRIVDNHNGMLELGT
1l0oA           NDPNGIVSISIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKPELERSGMGFT----IMENFMDEVIVES
1b3qA3          PKEERIAKSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDEGFSGVGMDVVKNVVESLNGSMGIES
2c2aA2          DAPDKVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD---TGLGLAITKEIVELHGGRIWVES
1f51A           NHLTVSLQTDHPDR-QLILYLDFHGAFADPSAFDDIRQNGYEDVDILIEIGL------------------
1r62A           EGGEII------------LRTRTAFQLTLHGERYRLAARIDVEDNPGIGLGLSIARNLIDQHSGKIEFTS
1gjvA2          YNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTT--AGFGFGLPTSRAYAEYLGGSLQLQS
1ys3A1          TLVQLSAVSSR---AGVEIAIDDNGSGVPEGERQVVFERFS--------LGLALVAQQAQLHGGTASLEN
1aj6A           GHCKEI---IVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGHGVGVSVVNALSQKLELVI
1mu5A3          HGILPNIKITIDLIDDYKVNVVDNGIGIPPQEVPNAFGRVLRQTRGMYGLGVKAAVLYSQMHQDKPIEIE
1csgA           ----------------------------------------------------------------------
1ea6A2          NIDLKLKDYGV-----DLIEVSDNGCGVEEENFEGLTLEALSSLCSTCHASAKVGTRLMFDHNGKIIQKT
1oanA1          -GKFKVVKEIAETQHGIVIRVQYEGDGSPCKIPFEI----MDLEKRHVLGRLITVNPIVTEKDSPVNIEA
2c2aA1          ----------------------------------------------------------------------
1wj5A           KGLVFQ--RDSGSDKLYYVTTKDKDLQSG-----------------------------------------
1p97A           ----------------------------------------------------------------------
1vpkA1          GDALVISSG--STVFRITTMPADEFPEIT-----------------------------------------
1qr0A2          -GIDIEKTKPISLEIAFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFILSLPLDSFSVRLHQDGQVSIEL
1d06A           ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1bknA2          RIDIDI-----ERGGAKLIRIRDNGCGIKKDEIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQ
1y8nA2          LYYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL----------------------------------
1d7eA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ya7O1          MYALRE--YLSARSTVED----------------------------------------------------
1pvgA2          PSXKRIDVNIHA--EEHTIEVKNDGKGIPIEIHNKENIYEKKVTGGRNGYGAKLCNIFSTEFILET----
2ookA1          ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1mkmA2          ----------------------------------------------------------------------
1b62A2          -GATRIDIDIERGGAK-LIRIRDNGCGIKKDELALALARHATSK--------------------------
1f5mA           ----------------------------------------------------------------------
1tfoA1          ----------------------------------------------------------------------
1rktA2          ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TIDEGTCFKVYLPVYEQx
1id0A           SMLGGARMEVIFGR----
1bxdA           SERGGLSIRAWLPV----
1l0oA           EVNKGTTVYLKKHIVK--
1b3qA3          EKDKGTKVTIRLPL----
2c2aA2          EVGKGSRFFVWIP-----
1f51A           ------------------
1r62A           W-PGHTEFSVYLPIRK--
1gjvA2          LQGIGTDVYLRLR-----
1ys3A1          SPLGGARLVLRLP-----
1aj6A           QHEGKIHRQIYEHGVPQ-
1mu5A3          TSPVNSKRIYTFKLK---
1csgA           ------------------
1ea6A2          PYPRPRGTTVSVQ-----
1oanA1          EPPFGDSYIIIGVEPGQ-
2c2aA1          ------------------
1wj5A           ------------------
1p97A           ------------------
1vpkA1          ------------------
1qr0A2          PDSHSPCYIKTYEV----
1d06A           ------------------
1joyA           ------------------
1bknA2          QEAWQAYAVT--------
1y8nA2          ------------------
1d7eA           ------------------
1bywA           ------------------
1ll8A           ------------------
1oj5A           ------------------
1s66L           ------------------
2oolA2          ------------------
2fi0A1          ------------------
2veaA3          ------------------
1utuA1          ------------------
3c2wA3          ------------------
1ya7O1          ------------------
1pvgA2          ------------------
2ookA1          ------------------
1g0dA1          ------------------
1g28A           ------------------
1mkmA2          ------------------
1b62A2          ------------------
1f5mA           ------------------
1tfoA1          ------------------
1rktA2          ------------------
1vp4A           ------------------