[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1orqC.bssp"
#ERROR : Can't open dsspfile "1bl8A.bssp"
#ERROR : Can't open dsspfile "1lnqA2.bssp"

## Summary of PDB Search
:298
    6e-06  25%  1orqC  [f.14.1.1] POTASSIUM CHANNEL
    1e-04  22%  1bl8A  [f.14.1.1] PROTEIN (POTASSIUM CHANNEL PROTEIN)
    1e-04  27%  1lnqA2 [f.14.1.1] POTASSIUM CHANNEL RELATED PROTEIN A:19 -- 98
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1orqC           ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1lnqA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1orqC           ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1lnqA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRFIPILMIVSWLF
1orqC           ---------------------------------------------------------FYHLFGAVMLTVL
1bl8A           ----------------------------------------------------------------------
1lnqA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFL
1orqC           YGAFAIYIVEYPDPNSSIKSVFDA----------LWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGIS
1bl8A           --------VIVLLAGSYLAVLAERGAPGAQLITYLWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
1lnqA2          -----LLVLAVIIYGTAGFHFIEGESWTVS----LYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIG


                         .         *         .         .         .         .         +:350
query           YSALFIGGLLAAFTSRSK
1orqC           ALTLLIG-----------
1bl8A           SFGLVTAALATWFVGREQ
1lnqA2          TFAVAVERLL--------