[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49715.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmnA1.bssp"
#ERROR : Can't open dsspfile "2basA2.bssp"
#ERROR : Can't open dsspfile "3by8A1.bssp"
#ERROR : Can't open dsspfile "1u89A1.bssp"
#ERROR : Can't open dsspfile "2p7jA2.bssp"
#ERROR : Can't open dsspfile "1ky9A2.bssp"
#ERROR : Can't open dsspfile "1oahA.bssp"
#ERROR : Can't open dsspfile "1otgA.bssp"
#ERROR : Can't open dsspfile "1l8wA.bssp"
#ERROR : Can't open dsspfile "1st6A3.bssp"
#ERROR : Can't open dsspfile "2aswA1.bssp"
#ERROR : Can't open dsspfile "1wa8B1.bssp"
#ERROR : Can't open dsspfile "2b0hA1.bssp"
#ERROR : Can't open dsspfile "1u89A1.bssp"
#ERROR : Can't open dsspfile "1oahA.bssp"
#ERROR : Can't open dsspfile "1st6A3.bssp"

## Summary of PDB Search
:621
    6e-18  10%  3cmnA1 [d.92.1.16] PUTATIVE HYDROLASE A:43 -- 391
    1e-14  21%  2basA2 [d.110.6.2] YKUI PROTEIN A:263 -- 407
    2e-14  12%  3by8A1 [d.110.6.1] SENSOR PROTEIN DCUS A:46 -- 178
    4e-13  10%  1u89A1 [a.216.1.1] TALIN 1 A:752 -- 889
    6e-13  18%  2p7jA2 [d.110.6.2] PUTATIVE SENSORY BOX/GGDEF FAMILY PROTEIN A:9 --
    5e-12  13%  1ky9A2 [b.47.1.1] PROTEASE DO A:11 -- 259
    1e-08   8%  1oahA  [a.138.1.3] CYTOCHROME C NITRITE REDUCTASE
    3e-08   4%  1otgA  [d.80.1.2] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE ISOMERASE
    3e-08  14%  1l8wA  [a.154.1.1] VLSE1
    9e-08   7%  1st6A3 [a.24.9.1] VINCULIN A:253 -- 371
    2e-06  37%  2aswA1 [a.274.1.1] HYPOTHETICAL PROTEIN AF1503 A:278 -- 331
    6e-06   6%  1wa8B1 [a.25.3.1] 6 KDA EARLY SECRETORY ANTIGENIC TARGET (ESAT-6)
    2e-04  11%  2b0hA1 [a.24.9.2] TALIN-1 A:1838 -- 1973
    9e-05  12%  1u89A1 [a.216.1.1] TALIN 1 A:752 -- 889(query 342->441)
    6e-05   6%  1oahA  [a.138.1.3] CYTOCHROME C NITRITE REDUCTASE(query 325->421)
    6e-04   8%  1st6A3 [a.24.9.1] VINCULIN A:253 -- 371(query 399->451)
:621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAINQKVKEGEMVASLIIREEIQHFLD
3cmnA1          ----------------------------------------------------------------------
2basA2          ----------------------------------------------------------------------
3by8A1          -----------------------------------------------------DMTRDGLANLAVARTLA
1u89A1          ----------------------------------------------------------------------
2p7jA2          --------------------------------------------NVENTAKEALHQLAYTGRE-YNNIQD
1ky9A2          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
3cmnA1          ----------------------------------------------------------------------
2basA2          ---------SLRKNNLSSDDDFIKKLAE--ELTDCSFRIYXCDEEGDQLTGNVFKEYAEKNWSWRPYFLE
3by8A1          DSPEIRQGLQ-----KKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHP--EAQRIGQPFKGDDILK
1u89A1          ----------------------------------------------------------------------
2p7jA2          QIETISDLLGHSQSLYKANLTILENXWSSARNQKLYKQIRFLDTSGTEKVRIKYDFKTSIDKSAREYFKY
1ky9A2          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLxxxxxxxxxxxxxxxxxx
3cmnA1          ----------------------------------------------------------------------
2basA2          NINLRKGFFSDLYSDLETGEXIRTFSYPXDDQ-----XYLFIDLPYSYLYEQ------------------
3by8A1          ALNGEE----NVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQ------------------
1u89A1          ----------------------------------------------------------------------
2p7jA2          AQSNEQISAWGIELERDKGEPSLRILXPI-SVNDVRQGYLVLNVDIEYLSSL------------------
1ky9A2          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cmnA1          ----------------------------------------------------------------------
2basA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
2p7jA2          ----------------------------------------------------------------------
1ky9A2          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------
2aswA1          ----------------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
3cmnA1          ----------------------------------------------------------------------
2basA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
2p7jA2          ----------------------------------------------------------------------
1ky9A2          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           --------------------------------------------GGLAEAFGFKSDPKKSDVKTYFTTVA
1st6A3          ----------------------------------------------------------------------
2aswA1          -------------------------------IIELSNTADKIAEGNLEAEVPHQRADEIGILAKSIERLR
1wa8B1          ----------------------------------------------------------------------
2b0hA1          -------------------------------------------------------------IAVTVQEMV
1u89A1          -------------------------------------------------------------AHATGAGPA
1oahA           --------------------------------------------DYVSAENSVGFHNPAKALDTLMTSME
1st6A3          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
3cmnA1          -------------------------IDWEQARQAALRLSQWEQAPVDNRAFYARMVALSEPLIADYLGVR
2basA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
2p7jA2          ----------------------------------------------------------------------
1ky9A2          -----SGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKXVGKDPRSDIALIQIQIKXADSDALRV
1oahA           ----------------------------------------------------------------------
1otgA           ----------------------------------------------------------------------
1l8wA           AKLEKTKTDLNSLPTAVEGAIKEVSELLDKLVKAVKTAEGASSGTAAIGE--------------------
1st6A3          ----------------------------------------------------------------------
2aswA1          RSLKVAM---------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          TKSNTSPEELGPLANQLTSDYGRLASQAKPAEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSD-VYTK
1u89A1          GRYDQATDTILTVTENIFSS-------MGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLS
1oahA           CSQKAVDLATEDFGIAPALAGDIKKLVPPILTLSRKLQQ-------DPEFLKQNPWTRLLPALPKAEQVW
1st6A3          ------------------------------------------------RREILGTCKTLGQMTDQLADLR


                         .         .         +         .         .         .         .:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKXXXXXXXXXXXXXXXNXXXXXXXXXXXXXGEHG
3cmnA1          LPEPVSRIFVFDRREWLEANIVSFSQLFRPIEEMYEKSSKLLGVQIGGLLGYLAQRVLGQYDLSLLSAGG
2basA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
2p7jA2          ----------------------------------------------------------------------
1ky9A2          GDYTVAIGNPFGLGETVTSGIVSALGRSGNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIG
1oahA           -------------------------------------------------------------------NYE
1otgA           ------------------------------------------------------------------ADGQ
1l8wA           ----------------------------------------------------------------------
1st6A3          ------------------------------------------------------------------KDTE
2aswA1          ----------------------------------------------------------------------
1wa8B1          ----------------------------------------------------------------------
2b0hA1          KELIECARRVSEKVSHVLAALQAGNR--------------------------------------------
1u89A1          AAKIDATAKMVEAAKGAAAHP-------------------------------------------------
1oahA           E---------------------------------------------------------------------
1st6A3          ARGQGATPMAMQKAQQVSQGLDLLTAKVENA---------------------------------------


                         *         .         .         .         .         +         .:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
3cmnA1          S-LYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEFEAYPWVRELLEQNFALTPEQRAVFDRIQALM
2basA2          ----------------------------------------------------------------------
3by8A1          ----------------------------------------------------------------------
1u89A1          QALNELLQHVK-AHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADA
2p7jA2          ----------------------------------------------------------------------
1ky9A2          IGFAIPSNXVKNLTSQXVEYGQ------------------------------------------------
1oahA           ALMAEAREMVRKGQLFWDYVSAENSVGFHNPAKALDTLMTSMECSQKAVDLATEATDFGIAPALIKKLVP
1otgA           HDYAFVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEI-EELHPTLNFKQNNVH---
1l8wA           ----------------------------------------------------------------------
1st6A3          AMKRALALIDSKMNQAKGWLRDPNAPPGDAGEQAIRQILDEALCAGKERREILGTCKTLGQMTDQLADLR
2aswA1          ----------------------------------------------------------------------
1wa8B1          --QQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLT-------------KLAAAWGGSGSEAYQGVQQKW
2b0hA1          ----------------------------------------------------------------------
1u89A1          ----------------------------------------------------------------------
1oahA           ----------------------------------------------------------------------
1st6A3          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EELVEKMAQITRATITMSASIQNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cmnA1          SLIEGYGNHVMNAVGRRLLPSFN--------------------------------------
2basA2          -------------------------------------------------------------
3by8A1          -------------------------------------------------------------
1u89A1          EGESDLENSRK--------------------------------------------------
2p7jA2          -------------------------------------------------------------
1ky9A2          -------------------------------------------------------------
1oahA           PILTLSRKLQQDPEFLKQNPWTRL-------------------------------------
1otgA           -------------------------------------------------------------
1l8wA           -------------------------------------------------------------
1st6A3          ARGQGATPMAMQKAQQVSQGLDLL-------------------------------------
2aswA1          -------------------------------------------------------------
1wa8B1          DATATELNNALQNLARTISEAGQ--------------------------------------
2b0hA1          -------------------------------------------------------------
1u89A1          -------------------------------------------------------------
1oahA           -------------------------------------------------------------
1st6A3          -------------------------------------------------------------