[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49801.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b3qA3.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1p2fA2.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1id0A.bssp"
#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1a2oA1.bssp"
#ERROR : Can't open dsspfile "2c2aA2.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "2b4aA1.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1l0oA.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1gjvA2.bssp"
#ERROR : Can't open dsspfile "1ny5A1.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "1ogcA.bssp"
#ERROR : Can't open dsspfile "1f51A.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1xrsB1.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "2nx2A1.bssp"
#ERROR : Can't open dsspfile "1qo0D.bssp"
#ERROR : Can't open dsspfile "1qr0A2.bssp"
#ERROR : Can't open dsspfile "1cb7A.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1xn8A.bssp"
#ERROR : Can't open dsspfile "1ea6A2.bssp"
#ERROR : Can't open dsspfile "1y8nA2.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"
#ERROR : Can't open dsspfile "1cvrA1.bssp"
#ERROR : Can't open dsspfile "1oanA1.bssp"
#ERROR : Can't open dsspfile "1gzhB2.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "1wj5A.bssp"
#ERROR : Can't open dsspfile "1vpkA1.bssp"
#ERROR : Can't open dsspfile "2c2aA1.bssp"
#ERROR : Can't open dsspfile "1utuA1.bssp"
#ERROR : Can't open dsspfile "1r8jA2.bssp"
#ERROR : Can't open dsspfile "1f5mA.bssp"
#ERROR : Can't open dsspfile "1skoA.bssp"
#ERROR : Can't open dsspfile "1jmwA.bssp"
#ERROR : Can't open dsspfile "1iovA1.bssp"
#ERROR : Can't open dsspfile "1pvgA2.bssp"
#ERROR : Can't open dsspfile "1joyA.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "1l8wA.bssp"
#ERROR : Can't open dsspfile "1ya7O1.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1g0dA1.bssp"

## Summary of PDB Search
:916
    4e-29  19%  1b3qA3 [d.122.1.3] PROTEIN (CHEMOTAXIS PROTEIN CHEA) A:355 -- 539
    4e-27  30%  1a0oA  [c.23.1.1] CHEY
    4e-27  21%  1bxdA  [d.122.1.3] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    2e-26  26%  1p2fA2 [c.23.1.1] RESPONSE REGULATOR A:1 -- 120
    3e-25  35%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    4e-25  24%  1id0A  [d.122.1.3] PHOQ HISTIDINE KINASE
    2e-24  12%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    3e-24  28%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-24  19%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    6e-24  20%  1dcfA  [c.23.1.2] ETR1 PROTEIN
    8e-24  31%  1oxbB  [c.23.1.1] SLN1
    3e-23  22%  1a2oA1 [c.23.1.1] CHEB METHYLESTERASE A:1 -- 140
    5e-23  32%  2c2aA2 [d.122.1.3] SENSOR HISTIDINE KINASE A:321 -- 481
    5e-23  33%  1tmyA  [c.23.1.1] CHEY PROTEIN
    1e-22  22%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    3e-22  27%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    4e-22  28%  1p6qA  [c.23.1.1] CHEY2
    4e-22  17%  2b4aA1 [c.23.1.1] BH3024 A:2 -- 119
    6e-22   9%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    9e-22  29%  1dz3A  [c.23.1.1] STAGE 0 SPORULATION PROTEIN A
    3e-21  15%  1l0oA  [d.122.1.3] ANTI-SIGMA F FACTOR
    1e-20  20%  1d5wA  [c.23.1.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-20  10%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    3e-20  20%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    4e-20  28%  1gjvA2 [d.122.1.4] [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE A:186 --
    9e-20  24%  1ny5A1 [c.23.1.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) A:1 --
    4e-19  22%  1r62A  [d.122.1.3] NITROGEN REGULATION PROTEIN NR(II)
    5e-19  25%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    2e-18  13%  1ogcA  [c.133.1.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    7e-18  14%  1f51A  [d.123.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE B
    9e-18  30%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    3e-17  16%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    3e-17   7%  1xrsB1 [c.23.6.1] D-LYSINE 5,6-AMINOMUTASE BETA SUBUNIT B:102 --
    4e-17  13%  1aj6A  [d.122.1.2] GYRASE
    4e-17   9%  2nx2A1 [c.129.1.2] HYPOTHETICAL PROTEIN YPSA A:1 -- 177
    6e-17  15%  1qo0D  [c.23.1.3] AMIR
    7e-17  11%  1qr0A2 [d.150.1.1] 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP A:102 --
    9e-17   9%  1cb7A  [c.23.6.1] PROTEIN (GLUTAMATE MUTASE)
    9e-17  27%  1l5yA  [c.23.1.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    5e-16  14%  1xn8A  [a.229.1.1] HYPOTHETICAL PROTEIN YQBG
    6e-16  10%  1ea6A2 [d.122.1.2] PMS1 PROTEIN HOMOLOG 2 A:27 -- 231
    8e-16  18%  1y8nA2 [d.122.1.4] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    1e-15  12%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
    2e-15   6%  1cvrA1 [b.1.18.12] GINGIPAIN R A:351 -- 432
    2e-15  11%  1oanA1 [b.1.18.4] ENVELOPE GLYCOPROTEIN A:298 -- 394
    3e-15  12%  1gzhB2 [c.15.1.4] TUMOR SUPPRESSOR P53-BINDING PROTEIN 1 B:1867 --
    6e-14  12%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    1e-13  12%  1dv7A  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    1e-12  14%  1wj5A  [a.4.5.59] HYPOTHETICAL PROTEIN (RIKEN CDNA 0610009H20)
    1e-11  15%  1vpkA1 [d.131.1.1] DNA POLYMERASE III, BETA SUBUNIT A:1 -- 120
    3e-11  21%  2c2aA1 [a.30.2.1] SENSOR HISTIDINE KINASE A:232 -- 320
    2e-09   7%  1utuA1 [a.283.1.1] EMSY A:11 -- 107
    3e-09  12%  1r8jA2 [c.23.1.5] KAIA A:1 -- 135
    1e-08  16%  1f5mA  [d.110.2.1] GAF
    2e-08   7%  1skoA  [d.110.7.1] MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
    3e-08  11%  1jmwA  [a.24.2.1] METHYL-ACCEPTING CHEMOTAXIS PROTEIN II
    2e-07  19%  1iovA1 [c.30.1.2] D-ALA\:D-ALA LIGASE A:1 -- 96
    7e-06  16%  1pvgA2 [d.122.1.2] DNA TOPOISOMERASE II A:7 -- 245
    7e-06  23%  1joyA  [a.30.2.1] PROTEIN (ENVZ_ECOLI)
    3e-05  11%  1csgA  [a.26.1.2] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    4e-05  12%  1l8wA  [a.154.1.1] VLSE1
    8e-05   4%  1ya7O1 [a.24.8.1] PROTEASOME ACTIVATOR PROTEIN PA26 O:4 -- 231
    1e-04  19%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    9e-04  13%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    9e-04   6%  1g0dA1 [b.1.18.9] PROTEIN-GLUTAMINE GAMMA-GLUTAMYLTRANSFERASE A:6
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxMKKFNNNIEEIVKNRYQKVILVATIQFEINNASRYLRDLILE
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------MNQQGFVISNELRQQQSELTWDLMLQTRINSAARMMMDASNQ
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYLKIEKTIYSLVQAGRRDEAKA
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           QSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFA
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VLYQNASVQTRLKLVQMIDDVGSIQQKQMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           QPTQGMQNALGEALGNYARVSENLYRQTF-----------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxRLDIVSSDEIGKISEVFNDMVEALEQHARQEKExxxxxQEQHWLKSK
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           -------------------------------------------------------------NKEEILEQL
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           -----------------------AFGFKSDPKKSDVKTYFTTVAAKLEKTKTDLNS--------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAEIMTLFQGVLDVKTFAQLLITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGE
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           LLSYEGLSDGQVNWSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQ----GKVACQMIQFGK
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLVGQCLLENKVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASxxxxxxxxxxxxxx
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           GVCGTAASTKETQIVPDVNKYPGHI--ACDGETKSEIVVPIISNDGKTLGVIDIDC--------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLENQYKESEQKTIELQKA
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------AQGDLTKEKKDLLGELSK
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------NETVEV
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          -----------------------------------------------------------------KRDEV


                         *         .         .         .         .         +         .:560
query           KTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETXXXXXXXXX
1b3qA3          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ---------DTALTNELI-HLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDA-----------
1s8nA           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          --TESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLE
1utuA1          VLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLM---------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------VKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSE-------------------------
1csgA           ISEMFDLQEPTCLRLELYKQGLRGSLTKLKGPLTMMASHYKQH---CPPTPETSCATQIIT---------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          VIKVQKEHGARDKWWFNQQGAQDEILLTLHSPANAVIGHYRLA---VLVMSPDGHIVERAD---------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQI
1b3qA3          -----------------------VPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEP
1a0oA           ----------------------------------------------------------------------
1bxdA           ------------------MPMEMADLNAVLGEVIAAESGYEREI----ETALYPGSI-EVKMHPLSIKRA
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           ---------------------ELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEIS--FVGEQNDFVEV
1mu5A3          -------------------------------------------------FKRNPELA-GFPNPARALYQT
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          ------------------INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQV
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           -------------------------MRNEMHLQFSARSENESFARVTVAAFVAQLDP--TMDELTEIKTV
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          --------------------HVPVDITDL---LDRAAHDAARIPDLDVSLVPSPTCI--IVGLPAGLRLA
1gjvA2          -------------------------------------------------VRINGHVAARFPFIPMPLDYI
1ny5A1          ----------------------------------------------------------------------
1r62A           ---------------------VTESIHKVAERVVTLVSMELPDNV-RLIRDYDPSLP-ELAHDPDQIEQV
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           ----------KHESKLSNLKTPHLAFDF------LTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRK
1s8nA           ----------------------------------------------------------------------
1bknA2          -----------------------------------------------------------------RPASV
1xrsB1          ----------------------------------------------------------------------
1aj6A           -------------------------------------------KGLDAVRKRPGMYI-GDTDDGTGLHHM
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          --------------------------------------------------------------VVLSLSTA
1y8nA2          -------------------------AYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHM
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           ---------EKIKEFLQEKKMQSFYQQELE--TVESLQSLASRPVTHSTGSDQ------VELKDSGTSGV
1vpkA1          ---------SKALAKKS---VKPILAGFLFEVKDGNFYICATDLETGVKATVNAAEEARFVVPGDVIQKM
2c2aA1          NLLNELLDFSRLERKSL-----------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          ------------------------------------------------------------------LFKI
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          -----------------RYQDLCHNVYCQAETIRTAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGS
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
1b3qA3          LLHLLRNAIDHGIEPKEERIAKGKPSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDLNFLFVPGF
1a0oA           ----------------------------------------------------------------------
1bxdA           VANMVVNAARYGNGWIKV-------SSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGD--SARTISG
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           MGNVLDNACKYCLEFVEISARQT-------DEHLYIVVEDDGPGIPLSKREVIFDRGQRVD----TLRPG
1mu5A3          VRELIENSLDATDVHILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSKYVNRQTRGM
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          LLNLLNNGVKYSKKDAPDKYVK--VILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFY---------RVD
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           VSEAVTNAIIHGYNNDPNGIVSISVIIEDG--VVHLTVRDEGVGIPDIEEARQPLFT------TKPELER
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          VDNAIANAVKHGGATLVQLSAVSSRA------GVEIAIDDNGSGVPEGERQVVFERFSLGLALVAQQAQL
1gjvA2          LPELLKNAMRATMESHLDTPYNVPDTIANNDVDLIIRISDRGGGIAHKDLDRVMDYHF----TTA----G
1ny5A1          ----------------------------------------------------------------------
1r62A           LLNIVRNALQALGPEGG---------------EIILRTRTAFQLTLHGERYRLAARIDV-----EDNGPG
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           LFHLFDQAVSRESENHLTVSLQ----TDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVFEITSHECL
1s8nA           ----------------------------------------------------------------------
1bknA2          VKELVENSLDAGATRID-------IDIERGGA-KLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGF
1xrsB1          ----------------------------------------------------------------------
1aj6A           VFEVVDNAIDEALAGHCKEIIVTIHA------DNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGL
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          -----------------------IEKTKPISLEISKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGK
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          VKELVENSLDAGATNIDLKLKDY--------GVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDTIST
1y8nA2          LFELFKNSMRATVELYEDRKEGYPALVTLGKEDLSIKISDLGGGVPLRKIDRLF----------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ----------YSMCGKFKVVKEIA---ETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLG-------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1wj5A           AQRVFKNALQLLQEKGL-VFQ----RDSGSDKLYYVTTKDKDLQSG------------------------
1vpkA1          VKVLPDEITELSLEGDALVIS-----SGSTVFRITTMPADEFPEIT------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          FDEILVNAADNKVRDPSXKRI----DVNIHAEEHTIEVKNDGKGIPIEIHNIPEXIFGHLLTSSNYDDGR
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          GEKSGSGGAPTPIGM-------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTE
1b3qA3          SGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP----------------------------------
1a0oA           ----------------------------------------------------------------------
1bxdA           TGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQ---------------------------
1p2fA2          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1id0A           QGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFG----------------------------------
1mu5A3          YGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTR------------
1b00A           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2c2aA2          TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP----------------------------------
1tmyA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l0oA           SGMGFTIMENF----MDEVIVESEVNKGTTVYLKKH----------------------------------
1d5wA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1ys3A1          HGGTASLENSP--------------LGGARLVLRLP----------------------------------
1gjvA2          FGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREE---------------------------
1ny5A1          ----------------------------------------------------------------------
1r62A           IGLGLSIARNLIDQHSGKIEFTSWPG-HTEFSVYLP----------------------------------
1w25A2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1f51A           IEIGL-----------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bknA2          RGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFN--------------
1xrsB1          ----------------------------------------------------------------------
1aj6A           HGVGVSVVN----ALSQKLELVIQHEGKIHRQIYEHGVPQAPLAVTG------ETEKTGTMVRFWPSLET
2nx2A1          ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1qr0A2          GLSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEGYKMAVCAAHPDFPEDITMVSYEELLR-------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1ea6A2          CHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQ--------
1y8nA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1oanA1          ---RLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKL---------------------------
1gzhB2          ----------------------------------------------------------------------
1e1cA2          ------------------------------------------------------------VYSKEVKNTP
1dv7A           ----------------------------------------------------------------------
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1pvgA2          NGYGAKLCNIFSTEFILET---------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EWSGDKVSLSQIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
1b3qA3          ----------------------------------------------------------------------
1a0oA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1bxdA           ----------------------------------------------------------------------
1p2fA2          ----------------------WKIAVVDDDKNILKKVSEKLQQLGRVKTFL----TGEDFLNDEEAFHV
1m5tA           -----------------------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENK-PDL
1id0A           ----------------------------------------------------------------------
1mu5A3          ----------------GFHGTSVAISIPGDWPKAKSRIYEYIKRPYAEFIFK-DPEGNVTYYPRLTN---
1b00A           ---------------------ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPW-PDL
1i3cA           --------------------PPKVILLVEDSKADSRLVQEVLKTSTIDHELIIFLQQQGEYENSPR-PNL
1dcfA           -------------------FTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEH--KV
1oxbB           -----------------------KILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFDKTSKGENYNM
1a2oA1          -------------------MSKIRVLSVDDSALMRQIMTEIINSHMEMVATAPDPLVARDLIKKFN-PDV
2c2aA2          ----------------------------------------------------------------------
1tmyA           ---------------------GKRVLIVDDAAFMRMMLKDIITKAGYEAGEATNGREAVEKYKELK-PDI
1a04A2          --------------------EPATILLIDDHPMLRTGVKQLISMAITVVGEASNGEQGIELAESLD-PDL
1f51E           -----------------------KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKER-PDL
1p6qA           --------------------EKIKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKI-MAQNPHHL
2b4aA1          --------------------QPFRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQLSTCDL
1tu1A           ------------------RLHEADLEIPDDQSINIFKLPASGPAREASFVISRDASQGDAPFAD---YVA
1dz3A           -----------------------KVCIADDNRELVSLLDEYISSQPDMIGTAYNGQDCLQMLEEKR-PDI
1l0oA           ----------------------------------------------------------------------
1d5wA           -------------------MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVR-NGV
1bmtA2          ----------------EQGKTNGKMVIATVKGIGKNIVGVVLQCNNYEIVDLGPAEKILRTAKEVNADLI
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          -----------------------NVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKH-FNV
1r62A           ----------------------------------------------------------------------
1w25A2          ---------------------GGRVLIVDDNERQAQRVAAELGVEHRPVIESDPEKAK---ISAGGPVDL
1ogcA           ------------------------------------------------GILNSHLAKILADLGHTD--KI
1f51A           ----------------------------------------------------------------------
1s8nA           ----------------------RRVLIAEDEALIRMDLAEMLREEGYEIVEAGDGQEAVELA-ELHKPDL
1bknA2          -------HIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRL--------------------
1xrsB1          ----------------------------MNMKGYAGHYGLERYEMIYNLGSQVANEDFIKKAVELE-ADV
1aj6A           FTNVTEFEYEIL---------AKRL------------RELSFLNSGVSIRLRDKRDGKEDHF--------
2nx2A1          -----------------------VLAITGYKPFE---LGIFKQDDKALYYIKKAIKNRLIAFLDE-GLEW
1qo0D           ------------------SLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDV------PVD
1qr0A2          ----------------------------------------------------------------------
1cb7A           -----------------------GVIGSDCHAVGNKILDHAFTNAGFNVVNIGPQELFIKAAIETKADAI
1l5yA           -----------------------SVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGI
1xn8A           ----------------------------------------------PDELKSYSVFES----VKTRPDEL
1ea6A2          -----------VLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSV---------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          -------------------MNIAPALVVDSSCLI---MNLQIKTYGQGSGNAATFINNHLLSTLVL-DQW
1cvrA1          ------------------SASAQTFEVACDYNGAIATLSDDGDMVGTAI--VKDGKAIIKLNESIA--DE
1oanA1          ----------------------------------------------------------------------
1gzhB2          -------------------FQNLKVLLVSDQQQNFLELWSEILMTGAASVKQHHSSAHNKD-IALGVFDV
1e1cA2          EVEEAR-ELVEEFEQAERRPRILLAKMGQDGHDRGQKVIAAYADLGFDVDVGPLFQTPEETARVEADVHV
1dv7A           -------------------------------------RVDVMDVMNILAMDLMNRDDALRVTGEVRE-YI
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          ------------------------ICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQHRDQIDC
1f5mA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1jmwA           ----------------------------------------------------------------------
1iovA1          -----------------------KIAVLLGGLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSM-GFQK
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          -----------------------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIAMNPKGI--
1qdlB           -----------------------LTLIIDNYDSFVYNIAQIVGELGSYPVIRNDEISIKGIERIDPDRLI
1g0dA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVW
1b3qA3          ----------------------------------------------------------------------
1a0oA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1bxdA           ----------------------------------------------------------------------
1p2fA2          VVLDVXLPDYSGYEICRXIKET--RPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRF
1m5tA           ILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRL
1id0A           ----------------------------------------------------------------------
1mu5A3          ---KIPKPPQE-----------------------------------------------------------
1b00A           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
1i3cA           ILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKXVQGI
1dcfA           VFMDVCMPGVENYQIALRIHEKFTQRHQRLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDL
1oxbB           IFMDVQMPKVDGLLSTKMIRRDLGY-TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF
1a2oA1          LTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTGKG-SEVTLRALELGAIDFVTKPQLGIREGMLAYSE
2c2aA2          ----------------------------------------------------------------------
1tmyA           VTMDITMPEMNGIDAIKEIMKI--DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALN--
1a04A2          ILLDLNMPGMNGLETLDKLREK--SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQA
1f51E           VLLDMKIPGMDGIEILKRMKVIDEN--IRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY
1p6qA           VISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAV
2b4aA1          LIVSDQLVDLSIFSLLDIVKEQTKQPSVLI-------LTTGRLIESSEHNLSYLQKPFAISELRAAIDYH
1tu1A           RQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMVFIERRPAVLITTLTTTPADLPHHEPA
1dz3A           LLLDIIMPHLDGLAVLERIRAGFEHQPNVIM-LTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQV
1l0oA           ----------------------------------------------------------------------
1d5wA           LVTXLRMPDMSGVELLRNLGDLKIN--IPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
1bmtA2          GLSGLITPSLDEMVNVAKEMERQGFTIPLLGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSD
1ys3A1          ----------------------------------------------------------------------
1gjvA2          ----------------------------------------------------------------------
1ny5A1          VLLDLLLPDVNGLEILKWIKERSP--ETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKA
1r62A           ----------------------------------------------------------------------
1w25A2          VIVNAAAKNFDGLRFTAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQ
1ogcA           VIADAGLPVPDGVLKIDLSLKPGLPA----FQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSE
1f51A           ----------------------------------------------------------------------
1s8nA           VIMDVKMPRRDGIDAASEIASKRIAPIVVL---TAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELA
1bknA2          ----------------------------------------------------------------------
1xrsB1          LLVSQTVTQKNVHIQTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKT
1aj6A           ----------------------------------------------------------------------
2nx2A1          ILISGQLGVLWAAEAAYDLQE--EYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYE
1qo0D           VVFTSIFQNRHHDEIAALLAAG--TPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSA
1qr0A2          ----------------------------------------------------------------------
1cb7A           LVSSLYGQGEIDCKGLRQKCDEAGLEGILLIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKD
1l5yA           VISDIRMPGMDGLALFRKI--LALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRA
1xn8A           LKQDILEATADIILKVGHDFS--DAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTL
1ea6A2          ----------------------------------------------------------------------
1y8nA2          ----------------------------------------------------------------------
2pggA1          NLMRQPRPDSEEFKSIEDKLGINFKIERSI-----DDIRGKLRQLVLLAQPGYLSGGVEPEQSSPTVELD
1cvrA1          TNLTLTVVGYNKVTVIKDVKV-------------------------------------------------
1oanA1          ----------------------------------------------------------------------
1gzhB2          VVTDPSCP--ASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQ-----HPKYKHDYV------------
1e1cA2          VGVSSLAGGHLTLVPALRKELDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVAISLVKKLR--
1dv7A           DTVKIGYPLVLSEGMDI-IAEFRKRFGCRIIADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNV
1wj5A           ----------------------------------------------------------------------
1vpkA1          ----------------------------------------------------------------------
2c2aA1          ----------------------------------------------------------------------
1utuA1          ----------------------------------------------------------------------
1r8jA2          LILVAANPSFRA----------------------------------------------------------
1f5mA           ----------------------------------------------------------------------
1skoA           ---------ADDLKRLYKKLP--SVEGLHAIVVSDRDGVPVIKVANDNAPEHAL-RPGFLSTFALATDQG
1jmwA           ----------------------------------------------------------------------
1iovA1          VFIALHGRGEDG-----TLQGMLELMGLPYTGSGVMA---------------------------------
1pvgA2          ----------------------------------------------------------------------
1joyA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1l8wA           ----------------------------------------------------------------------
1ya7O1          ----------------------------------------------------------------------
1wl8A1          IFSGGPSLENTGNCEKVLEHYD--EFNVPILGIC------------------------------------
1qdlB           ISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCL-----------------------------------
1g0dA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           LYRKVN
1b3qA3          ------
1a0oA           FEK---
1bxdA           ------
1p2fA2          LERE--
1m5tA           LERQ--
1id0A           ------
1mu5A3          ------
1b00A           MRR---
1i3cA           ESFW--
1dcfA           LEPR--
1oxbB           ------
1a2oA1          MIA---
2c2aA2          ------
1tmyA           ------
1a04A2          AAGE--
1f51E           L-----
1p6qA           FGAL--
2b4aA1          K-----
1tu1A           WKQ---
1dz3A           YGK---
1l0oA           ------
1d5wA           SEHLV-
1bmtA2          TQRD--
1ys3A1          ------
1gjvA2          ------
1ny5A1          IHRKL-
1r62A           ------
1w25A2          IQRK--
1ogcA           QEIE--
1f51A           ------
1s8nA           VSRF--
1bknA2          ------
1xrsB1          LNDRMN
1aj6A           ------
2nx2A1          SPL---
1qo0D           RRIS--
1qr0A2          ------
1cb7A           LNIE--
1l5yA           EKKR--
1xn8A           GDGS--
1ea6A2          ------
1y8nA2          ------
2pggA1          ------
1cvrA1          ------
1oanA1          ------
1gzhB2          ------
1e1cA2          ------
1dv7A           AEE---
1wj5A           ------
1vpkA1          ------
2c2aA1          ------
1utuA1          ------
1r8jA2          ------
1f5mA           ------
1skoA           SKL---
1jmwA           ------
1iovA1          ------
1pvgA2          ------
1joyA           ------
1csgA           ------
1l8wA           ------
1ya7O1          ------
1wl8A1          ------
1qdlB           ------
1g0dA1          ------