[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49907.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xt8A1.bssp"
#ERROR : Can't open dsspfile "1gggA.bssp"
#ERROR : Can't open dsspfile "1hslA.bssp"
#ERROR : Can't open dsspfile "1ii5A.bssp"
#ERROR : Can't open dsspfile "1nh7A1.bssp"
#ERROR : Can't open dsspfile "1z7mE1.bssp"
#ERROR : Can't open dsspfile "1pb7A.bssp"
#ERROR : Can't open dsspfile "1hq6.1.bssp"
#ERROR : Can't open dsspfile "1ftjA.bssp"
#ERROR : Can't open dsspfile "1zbmA1.bssp"
#ERROR : Can't open dsspfile "1h3dA1.bssp"
#ERROR : Can't open dsspfile "3btaA2.bssp"
#ERROR : Can't open dsspfile "1us4A.bssp"
#ERROR : Can't open dsspfile "1o63A.bssp"

## Summary of PDB Search
:277
    5e-48  26%  1xt8A1 [c.94.1.1] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC A:10
    9e-48  29%  1gggA  [c.94.1.1] GLUTAMINE BINDING PROTEIN
    7e-45  34%  1hslA  [c.94.1.1] HISTIDINE-BINDING PROTEIN
    4e-43  20%  1ii5A  [c.94.1.1] HYPOTHETICAL PROTEIN SLR1257
    1e-37  12%  1nh7A1 [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE A:1 -- 210
    1e-35  12%  1z7mE1 [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE E:1 -- 204
    1e-32  21%  1pb7A  [c.94.1.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    6e-30  12%  1hq6.1 [d.155.1.1] HISTIDINE DECARBOXYLASE A:- -- - B:- -- -
    3e-29  21%  1ftjA  [c.94.1.1] GLUTAMATE RECEPTOR SUBUNIT 2
    2e-28   7%  1zbmA1 [c.94.1.1] HYPOTHETICAL PROTEIN AF1704 A:2 -- 261
    1e-25  12%  1h3dA1 [c.94.1.1] ATP-PHOSPHORIBOSYLTRANSFERASE A:5 -- 224
    3e-12  10%  3btaA2 [b.42.4.2] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1079 --
    8e-07  20%  1us4A  [c.94.1.1] PUTATIVE GLUR0 LIGAND BINDING CORE
    4e-04  16%  1o63A  [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE
:277

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxQAANQEPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
1xt8A1          ------------------------------------------NSLDKIKQNGVVRIGVFGDKPPFGYVDE
1gggA           -----------------------------------------------------LVVATDTAFVPFEFKQG
1hslA           -------------------------------------------------IPQKIRIGTDPTYAPFESKNA
1ii5A           ----------------------------------------------------------------------
1nh7A1          ----------------------------------------------------MLRVAVPNKGALSEPATE
1z7mE1          ----------------------------------------------------MIKIAITKGRIQKQVTK-
1pb7A           ----------------------------------------------------------------------
1hq6.1          -------------------------------------------DAGVRRAETKNAYIGQINMTTASFTGV
1ftjA           --------------------------------------------------------------------EG
1zbmA1          ----------------------------------------------------------------------
1h3dA1          -----------------------------------------------------LRIAMQKSGRLSDDSRE
3btaA2          -----------------------------VEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDN
1us4A           ----------------------------------------------------------------------
1o63A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
1xt8A1          KGNNQGYDIALAKRIAKELENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVAL
1gggA           -DLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGL
1hslA           QGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADS
1ii5A           -GAFTGISLDVWRAVAESQKWNSEYRQNSISAGITAVAEGELDILIGPISVTPERAAIITFTQPYFSSGI
1nh7A1          ILAEAGRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSGELDFGITGRDLVCDSGAQVRERLALGFGSS
1z7mE1          LLENADYDVEPIRELQIKTKDDLQIIFGKPNDVITFLEHGIVDIGFVGKDTLDENDFDDYYELLYLKIGQ
1pb7A           -----GFCIDLLIKLARTMNFTYEVHLVEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
1hq6.1          QGRVIGYDILRSPEVDKAKPLFTETQWDGSE-LPIYDAKPLQDALVEYFGTEQDRRH-YPAPGSFIVCAN
1ftjA           NERYEGYCVDLAAEIAKHCGFKYKLTIKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
1zbmA1          ------------THGKVDTWLEIEHVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGD
1h3dA1          LLARCGIKINLHTQIAMAENMPIDILRVRDDDIPGLVMDGVVDLGIIGRRAQGEDPRYFTLRRLDFGGCR
3btaA2          NGNDIGFIGF------HQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERP-----------
1us4A           -----GVYFPVATGIAKNVGIRANARSTGGSVANIAINAGEFEXALAQNDIAGKPVKTIRALAALYPEVV
1o63A           -------------------GKDIVCFXVRPFDVPTYLVHGVADIGFCGTDVLLEKETSLIFFIPTNISRX


                         +         .         .         .         .         *         .:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
1xt8A1          GVAVPKDS-NITSVEDLKDKTLLLNKGTTADAYFTQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTL
1gggA           LVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPN
1hslA           RLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKEIVSYQGQDNIYSDLTAGRIDAAFQDEVA
1ii5A           LLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQ--ADVRETNNLTAAITLLQKKQVEAVMFDRPA
1nh7A1          SFRYAAPAGRNWTTADLAGMRIATAYPNLVRKDLAT--KGIEATVIRLDGAVEISVQLGVADAIADVVGS
1z7mE1          CIFALASYPDFSNKNFQRHKRIASKYPRVTKKYFAQK--QEDIEIIKLEGSVELGPVVGLADAIVDIVET
1pb7A           TILVKKGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTKHNYESAAEAIQAVRDNKLHAFIWDS-A
1hq6.1          KGVTAERPKNDADMKPGQGYGVWSAIAISFAKDPTKEDELLEYLEGRRKAMAKSIAECGQDAHASFESSW
1ftjA           SIMIKKG--TPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFRTTAEGVARVRKSKGKYAYLLEST
1zbmA1          GYGPVV---VAKSEISLDGKRIAVPGRYTTANLLLKLAVEDFEPVEXPFDRIIQAVLDEEVDAGLLIHEG
1h3dA1          LSLATPVDEAWDGPLSLNGKRIATSYPHLLKRYLDQK--GISFKSCLLNGSVEVAPRAGLADAICDLVST
3btaA2          ----------------------------------------------------------------------
1us4A           HVVARKDA-GIRTVADLKGKRVVVGDVGSGTEQILEAYGLTFDDLGQSASQGIQLXQDKRADALFYTVGL
1o63A           VLAGPKG-----RGIPEGEKRIATKFPNVTQRYCES-KGW-HCRIIPLKGSVELAPIAGLSDLIVDITET


                         .         .         .         +         .         .         .:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK
1xt8A1          LFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLKAHF---
1gggA           ILYFIKTANGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE----
1hslA           ASEGFLKQGKDYKFGGPAVKDEKLGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVY--
1ii5A           LIYYTRQNPNLNEVTEIRVSLEPYGFVLKENSP-LQKTINVEMLNLLYSRVIAEFTERWL-------
1nh7A1          GRTLSQHD---LVAFGEPLCDSEAVLIEREARDQLVARVQGVVF-----------------------
1z7mE1          GNTLSANG---LEVIEKISDISTRMIVNKSSFKFKKDKIIEMVERLE--------------------
1pb7A           VLEFEASQKCDLVTTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWV-------
1hq6.1          IGFAYTMM--EPGQIGNAITVAPYVSLPIDSIPGGSILTPDKDMEIMENLTMPKMGYKSLSANNALK
1ftjA           MNEYIEQRKPDTMKVGGNLDSKGYGIATPK-GSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECE
1zbmA1          QITYADYGLKCVLDLWDWWSEQVLNAIRRDLSVEVQEEFLRAXRESIADEAIEYAXKYSRGLDRER-
1h3dA1          GATL---EANGLREVEVIYRSKACLIQRDGEMEESKQQLIDKLLT----------------------
3btaA2          -------------------------------------------------------------------
1us4A           GASAIQQLALTTPIALVAVDLN-RIQAIAKKYPFYVGFN----------------------------
1o63A           GRTL---KENNLEILDEIFVIRTHVVVNPVSYRTKREEVVSFLEKLQE-------------------