[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO49938.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w3bA.bssp"
#ERROR : Can't open dsspfile "1ya0A1.bssp"
#ERROR : Can't open dsspfile "1omxA.bssp"
#ERROR : Can't open dsspfile "1qsaA1.bssp"
#ERROR : Can't open dsspfile "1xhbA2.bssp"
#ERROR : Can't open dsspfile "1h7lA.bssp"
#ERROR : Can't open dsspfile "2dm9A1.bssp"
#ERROR : Can't open dsspfile "1xnfA.bssp"
#ERROR : Can't open dsspfile "1zbpA1.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "2bo4A1.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "2fbnA1.bssp"
#ERROR : Can't open dsspfile "1hz4A.bssp"
#ERROR : Can't open dsspfile "2ooeA1.bssp"
#ERROR : Can't open dsspfile "1elrA.bssp"
#ERROR : Can't open dsspfile "1e96B.bssp"
#ERROR : Can't open dsspfile "1b89A.bssp"
#ERROR : Can't open dsspfile "1d8dA.bssp"
#ERROR : Can't open dsspfile "1elwA.bssp"
#ERROR : Can't open dsspfile "1q7sA.bssp"
#ERROR : Can't open dsspfile "2cptA1.bssp"
#ERROR : Can't open dsspfile "2pqnA1.bssp"
#ERROR : Can't open dsspfile "2fezA2.bssp"
#ERROR : Can't open dsspfile "2crbA1.bssp"
#ERROR : Can't open dsspfile "1a87A.bssp"
#ERROR : Can't open dsspfile "1kt0A1.bssp"
#ERROR : Can't open dsspfile "3ck7A1.bssp"
#ERROR : Can't open dsspfile "2c2lA1.bssp"
#ERROR : Can't open dsspfile "1nznA.bssp"
#ERROR : Can't open dsspfile "2fsqA1.bssp"
#ERROR : Can't open dsspfile "1zu2A1.bssp"
#ERROR : Can't open dsspfile "1hxiA.bssp"
#ERROR : Can't open dsspfile "1fchA.bssp"
#ERROR : Can't open dsspfile "1tjcA.bssp"
#ERROR : Can't open dsspfile "1a17A.bssp"
#ERROR : Can't open dsspfile "1xnfA.bssp"
#ERROR : Can't open dsspfile "1zbpA1.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "2fbnA1.bssp"
#ERROR : Can't open dsspfile "2ooeA1.bssp"
#ERROR : Can't open dsspfile "1elrA.bssp"
#ERROR : Can't open dsspfile "1e96B.bssp"
#ERROR : Can't open dsspfile "1d8dA.bssp"
#ERROR : Can't open dsspfile "1elwA.bssp"
#ERROR : Can't open dsspfile "2cptA1.bssp"
#ERROR : Can't open dsspfile "2pqnA1.bssp"
#ERROR : Can't open dsspfile "2fezA2.bssp"
#ERROR : Can't open dsspfile "2crbA1.bssp"
#ERROR : Can't open dsspfile "1a87A.bssp"
#ERROR : Can't open dsspfile "1kt0A1.bssp"
#ERROR : Can't open dsspfile "2c2lA1.bssp"
#ERROR : Can't open dsspfile "1hxiA.bssp"
#ERROR : Can't open dsspfile "1tjcA.bssp"

## Summary of PDB Search
:640
    5e-23  14%  1w3bA  [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
    1e-15   8%  1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
    4e-15  14%  1omxA  [c.68.1.15] ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2
    2e-14   6%  1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
    6e-14  20%  1xhbA2 [c.68.1.17] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1
    1e-12  13%  1h7lA  [c.68.1.1] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
    5e-11  12%  2dm9A1 [d.81.4.1] V-TYPE ATP SYNTHASE SUBUNIT E A:81 -- 198
    6e-11  18%  1xnfA  [a.118.8.1] LIPOPROTEIN NLPI
    6e-11  15%  1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265
    1e-10   8%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
    1e-09  15%  2bo4A1 [c.68.1.18] MANNOSYLGLYCERATE SYNTHASE A:2 -- 382
    2e-09  16%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
    5e-09  11%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    1e-07  12%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
    1e-07  16%  2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22
    2e-07  15%  1hz4A  [a.118.8.2] MALT REGULATORY PROTEIN
    3e-07   9%  2ooeA1 [a.118.8.7] CLEAVAGE STIMULATION FACTOR 77 KDA SUBUNIT A:21
    3e-07  15%  1elrA  [a.118.8.1] TPR2A-DOMAIN OF HOP
    4e-07  14%  1e96B  [a.118.8.1] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,
    5e-07  10%  1b89A  [a.118.1.3] PROTEIN (CLATHRIN HEAVY CHAIN)
    8e-07   9%  1d8dA  [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
    1e-06  22%  1elwA  [a.118.8.1] TPR1-DOMAIN OF HOP
    1e-06  12%  1q7sA  [c.131.1.1] BIT1
    2e-06  16%  2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111
    4e-06  13%  2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129
    5e-06  11%  2fezA2 [a.118.8.3] PROBABLE REGULATORY PROTEIN EMBR A:105 -- 283
    5e-06  10%  2crbA1 [a.7.16.1] NUCLEAR RECEPTOR BINDING FACTOR 2 A:8 -- 90
    6e-06   8%  1a87A  [f.1.1.1] COLICIN N
    8e-06  17%  1kt0A1 [a.118.8.1] 51 KDA FK506-BINDING PROTEIN A:254 -- 412
    1e-05   7%  3ck7A1 [a.118.8.6] SUSD A:42 -- 551
    2e-05   8%  2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
    2e-05  14%  1nznA  [a.118.8.1] FISSION PROTEIN FIS1P
    3e-05   9%  2fsqA1 [d.61.1.4] ATU0111 PROTEIN A:6 -- 237
    1e-04  15%  1zu2A1 [a.118.8.1] MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM20-3
    2e-04  19%  1hxiA  [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    2e-04   9%  1fchA  [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    6e-04  18%  1tjcA  [a.118.8.1] PROLYL 4-HYDROXYLASE ALPHA-1 SUBUNIT
    6e-04  11%  1a17A  [a.118.8.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    3e-05  17%  1xnfA  [a.118.8.1] LIPOPROTEIN NLPI(query 558->626)
    4e-07  24%  1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265(query 563->632)
    2e-07  29%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524(query 550->618)
    2e-06  17%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365(query 557->619)
    5e-04  13%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365(query 387->505)
    4e-05  13%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN(query 581->626)
    4e-06   7%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18(query 558->613)
    1e-04  13%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18(query 418->486)
    5e-06  18%  2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22(query 557->627)
    8e-05   8%  2ooeA1 [a.118.8.7] CLEAVAGE STIMULATION FACTOR 77 KDA SUBUNIT A:21(query 558->632)
    3e-05  14%  1elrA  [a.118.8.1] TPR2A-DOMAIN OF HOP(query 548->627)
    4e-04   6%  1e96B  [a.118.8.1] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,(query 588->619)
    7e-05   8%  1d8dA  [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)(query 575->627)
    3e-04  13%  1elwA  [a.118.8.1] TPR1-DOMAIN OF HOP(query 542->627)
    6e-06  25%  2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111(query 580->634)
    4e-05  13%  2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129(query 209->305)
    7e-05   8%  2fezA2 [a.118.8.3] PROBABLE REGULATORY PROTEIN EMBR A:105 -- 283(query 552->626)
    2e-04  14%  2crbA1 [a.7.16.1] NUCLEAR RECEPTOR BINDING FACTOR 2 A:8 -- 90(query 269->360)
    2e-04  12%  1a87A  [f.1.1.1] COLICIN N(query 544->627)
    2e-05  15%  1kt0A1 [a.118.8.1] 51 KDA FK506-BINDING PROTEIN A:254 -- 412(query 211->305)
    7e-04   9%  2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN(query 190->355)
    6e-04  17%  1hxiA  [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5(query 266->341)
    7e-04  16%  1tjcA  [a.118.8.1] PROLYL 4-HYDROXYLASE ALPHA-1 SUBUNIT(query 558->627)
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
1w3bA           ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1omxA           --DSFTLIMQTYNRTDLLLRLLNHYQAVLHKVIVVWNNVKGPEELWNSPHPIPVIFKPQTANKMRNRLQV
1qsaA1          ----------------------------------------------------------------------
1xhbA2          ---TTSVVIVFHNEAWSTLLRTVHSRHMIEEIVLVDDASERDFLKRPLESYVKVIRMEQRSGLIRARLKG
1h7lA           ---KVSVIMTSYNKSDYVAKSISSITFSDFELFIMDDNSNEETLNVIRPFLNDVKERTEKTRYAALINQA
2dm9A1          --------------------IISSVVKRRLETMSEDEYFESVKALLKEAIKELVMSNEKTLGLIASRIEE
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          -----LVVFPFKHEHPEVLLHNVRVAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGGDGMNTALRYF
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------------------------------------
2fsqA1          ----------------------------------------------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR
1w3bA           ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1omxA           FPEVETNAVLMVDDDTLISAQDLVFAFSI-----------------------------------------
1qsaA1          ----------------------------------------------------------------------
1xhbA2          AAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFR
1h7lA           IEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNA----
2dm9A1          IKSELGDVSIELGETVDTMGGVIVETEDGR--IRIDNTFEARMERFEG----------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          LEETQWERIHFYDADITSFGPDWITKAEEAADFGYGLVRHYFPRASTDAMITWMITRTGFALLWPH----
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------------------------------------
2fsqA1          ----------------------------------------------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQKDKKNRNLHIIQKEMVENPGNYLLKYHY
1w3bA           ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1omxA           ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------DSLDEQRSRYAQ
1xhbA2          W---------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2ooeA1          -----------------------------------------CSKDKSVAFKIFELGLKKYGDIPEYVLAY
1elrA           ----------------------------------------------------------------------
1e96B           ------------------------------------------------------------LVEAISLWNE
1b89A           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          -----------------------------------------VLDDLRDFQFVEPFATALVEDKVLAHTAK
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------------------------------------
2fsqA1          ----------------------------------------------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
1tjcA           -------------------------------------------------------------------FEL
1a17A           ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          --------------------------------------------------------------------DF
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
2c2lA1          -------------------------------------------------AACYGRAITRNPLVAVYYTNR
1hxiA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
1w3bA           ---------------------------------------HREYQAGDFEAAERHCMQLWRQEPDNTGVLL
1ya0A1          -------------------------------------------------QSAQYLRQAEVLKADMTDSKL
1omxA           ----------------------------------------------------------------------
1qsaA1          IKQAWDNRQMDVVEQMMPGLKDYPLYPYLEY-----RQITDDLMNQPAVTVTNFVRANPTLPPARTLQQC
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           AVPLQPTLQQEVILARXEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDXPEVFN
1zbpA1          -------------------------------------------SEGQLQQALELLIEAIKASPKDASLRS
2cfuA2          -----------------------------RAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLL
2bo4A1          ----------------------------------------------------------------------
1ihgA1          ---GDSHPDFPEDADVDLKDVDKI----LLISEDLKNIGNTFFKSQNWEMAIKKDADGAKLQPVALSCVL
1ouvA           -------------------------------PKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNL
1wfdA           ----------------------------------------------------------------AAVAVL
2fbnA1          --KYKEALDFFIHTEEWDDQILLDKK-KNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALY
1hz4A           -----------------------------------------------------------------AEFNA
2ooeA1          IDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEKET
1elrA           -------------------------------ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIT
1e96B           GVLAADKKDWKGALDAFSAV-------QDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYF
1b89A           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------LSLDSPTYVLYR
1elwA           -------------------------------VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYS
1q7sA           ------------------------------------KMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWE
2cptA1          ----------------------------------------------------------TSPNLQKAIDLA
2pqnA1          ----------------------------------------------------------------------
2fezA2          AEAEIACGRASAVIAELEALTFEHPYR----EPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDP
2crbA1          ----------------------------------------------------------------------
1a87A           ------SGMGDKLGEYLGVKYEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVAWKQV
1kt0A1          ----------------------------------------------------------------------
3ck7A1          ---------QQGVFVKGYAMLGVTDEGESGFYRTCNELPTDECLWAWQKNQDIPQLTSISWSPSSQRTEW
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------ELVSVEDLLKFEKKFQSEKAAGSVSKSTQF
2fsqA1          ----------------------------------------YISTANHDQPPRHLGSRFSAEGEFLPEPGN
1zu2A1          ----------------------------------------EFDRILLFEQIRQDAENTYKSNPLDADNLT
1hxiA           ----------------------------------------------------------------------
1fchA           -----------------------------GYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSGGAMS
1tjcA           GKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYAVYQQGDLDKALLLTKKLLELDPEHQRANG
1a17A           -----------------------------------------------------------DGALKRAEELK
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          WPTLKDAYLYPQQLEILRQQVVSEGGPTATIQSRFNYGLIKSTDVNDERLGVKILTDIYKEAERRRECLY
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------MEGPLNLAHQQS
1a87A           ----------------------------------------------------------------------
1kt0A1          GTVYFKGGKYMQAVIQYGKIVSESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLY
2c2lA1          ALCYLKMQQPEQALADCRRALELDG----QSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFG
1hxiA           -------------------------------------------------------EAVCQKEPEREEAWR
1tjcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
1w3bA           LLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG-----------QLQEAIEHYRHALRL
1ya0A1          GPAEVWTSRQALQDLYQKMLVTDLEYALDKKV------------EQDLWNHAFKNQITTLQGQAKNRANP
1omxA           ----------------------------------------------------------------------
1qsaA1          NYYYAKWNTGQSEEAWQGAKELWLTGKSQPNACDKLFSVWRASGKQDPLAYLERIRLAMKAGNTGLVTVL
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           YLGIYLTQAGNFDAAYEAFDSVLEL---DPTYN--------YAHLNRGIALYYGGRDKLAQDDLLAFYQD
1zbpA1          SFIELLCIDGDFERADEQLXQSIKLPEYLPGASQLR-----HLVKAAQA------RKDFAQGAATAKVLG
2cfuA2          EQARASYARGEYRWVVEVVNRLVFAEPDNRAA-----------RELQADALEQLGYQAENAGWRNSYLSA
2bo4A1          ----------------------------------------------------------------------
1ihgA1          NIGACKLKMSDWQGAVDSCLEALEIDPSNTKA-----------LYRRAQGWQGLKEYDQALADLKKAQEI
1ouvA           GVLYYQGQGVEKNLKKAASFYAKAC-----------DLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSK
1wfdA           KRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESS----KRCVLRTKISGYMDRAENIKKYLDQEKED
2fbnA1          KLGVANMYFGFLEEAKENLYKAASLPNNLDIRNSYE-----LCVNKLKEARK------------------
1hz4A           LRAQVAINDGNPDEAERLA--KLALEELPPG----WFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQM
2ooeA1          ALLVDRYKFMDLYPCSASELKALGYKD-------------------------------------------
1elrA           NQAAVYFEKGDYNKCRELCEKAIEGRENREDYRQIAKAY-----ARIGNSYFKEEKYKDAIHFYNKSLAE
1e96B           QRGMLYYQTEKYDLAIKDLKEALIQLRGNQLID-------YKILGLQFKLFACEVLYNIAFMYAKKEEWK
1b89A           ----------------------------------------------------------------------
1d8dA           DRAEWADIDPVPQNDGPSPVVQIIYSEKFRDV-----------YDYFRAVLQRDERSERAFKLTRDAIEL
1elwA           NRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRK----AAALEFLN-------RFEEAKRTYEEGLKH
1q7sA           YCGQPKVVVKDEETLIALLAHAKMLGLTVSLIQDAG-----RTQIAPGTVLGIGPGPADLIDKVTGHLK-
2cptA1          SKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGD----KAKQSIRAKCTEYLDRAEKLKEYLKN---
2pqnA1          ----------------------------------------------------------------------
2fezA2          GPTLRALNERILRQQ-------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           NAKDMANKIGNLGKAFKVADLAIKVEKIREKS------IEGYNTGNWGPLLLEVESWIIGGVVAGVAISL
1kt0A1          ----------------------------------------------------------------------
3ck7A1          VYVRLGYDITQYNFFLDQTEGMTDAETLRQR---------AEIRFLRALHYWYFLDLFGKAPFKEHFSND
2c2lA1          ----------------------------------------------------------------------
1nznA           EYAWCLVRTRYNDDIRK------GIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT
2fsqA1          TVVCHLVEGSQTESAIVSTRQRFLD-XPEASQLAFTPVSSLHXTVFQGVI-------ESRRALP-YWPQT
1zu2A1          RWGGVLLELSMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDE
1hxiA           ----------------------------------------------------------------------
1fchA           ENRLALSMLGQSDAYGAADARDLS----------------------------------------------
1tjcA           NLKYFEYIMA------------------------------------------------------------
1a17A           TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRS----LAYLRTECYGYALGDAT---RAIELDKKY
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          YLTIGCYKLGEYSMAKRYVDTLFEH---------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          RRADRLLAAGKYEEAISCHRKATTYLSE------------AMKLTESEQAHLSLELQRDSHMKQLLLIQE
1a87A           ----------------------------------------------------------------------
1kt0A1          RRGEAQLLMNEFESAKGDFEKVLEV---------------------------------------------
2c2lA1          DDIPSALRIAKKKRWNSIEERRIHQSELHSYLTRLIAAERERELHIRAQQACIEAKHDKYMADMDELFSQ
1hxiA           SLGLTQAENEKDGLAIIALNHARXLPKDIAVHAALA-----VSHTNEHNANAALASLRAWL---------
1tjcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS
1w3bA           KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNF
1ya0A1          NRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSN
1omxA           ----------------------------------------------------------------------
1qsaA1          AGQMPADYQTIASAIISLANNPNTVLTFARTTGATQMAAVAFASVARQDAENARLMIPSLAQAQQLNEDQ
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           DPN-DPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEVEFYLGNISEQTLXERLKADATD-NTSLAEHL
1zbpA1          ENEELTKSLVSFNLSXVSQDYEQVSELALQIEELRQEKGFLANDTSFSDVRDIDDRLGGYIELFSTAYFL
2cfuA2          AYELRHGVPR------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1ihgA1          APEDKAIQAELLKV--------------------------------------------------------
1ouvA           ACDLKYAEGCASLGGIYHD---------------------------------------------------
1wfdA           GK--------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           ARQHDVWHYAL--------------------------WSLIQQSEILFAQGFLQTAWETQEKAFQLINEQ
2ooeA1          ----------------------------------------------------------------------
1elrA           HRTPDVLKKCQQAEKI------------------------------------------------------
1e96B           KAEEQLALATSMKSEPRHSKIDKAMECVWKQKL-------------------------------------
1b89A           ----------------------------------------------------------------------
1d8dA           NAANYTVWHFRRVLL-------------------------------------------------------
1elwA           EANNPQLKEGLQNMEA------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           FGAVLSFLPISGLAVT------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
3ck7A1          LPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKA-----ANWLLRARLYLNAGVYTGQTDYAKAE
2c2lA1          ----------------------------------------------------------------------
1nznA           EPQNNQAKELERLIDK------------------------------------------------------
2fsqA1          LPLDTPIDAVTDYYR-----------------------------DRLSTFPTLPAFNXRVTGLRPVGXVX
1zu2A1          QPDNTHYLKSLEMTAK------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           IKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSL
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          ------------------------------------SEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGS
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           -------------------------------------------------------------------STA
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          RWKRAKREER------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
2c2lA1          VDEKR-----------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
1w3bA           AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAV
1ya0A1          GQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKFIKF
1omxA           ----------------------------------------------------------------------
1qsaA1          IQELRDIVAWRLMGNDVTDEQAKWRDDAIMRSQSTSLIERRVRMALGTGDRRGLNTWLARLPMEAK-EKD
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           SETNFYLGKYYLSLGDLDSATA------------------------------------------------
1zbpA1          VPIASINTLEIKSATSLLESV-------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           HLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQ
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
3ck7A1          EYASKVIGSAYKLCTNYSE---------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------------------------------------
2fsqA1          KGATAEDDSIVALWRDTFADFFGYRHPDHDTYEFHI----------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           DIESMTIEDEY-----------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ihgA1          LSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAP--ED
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1wfdA           AVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDRAENIKKYLD----
2fbnA1          ----------------------------------------------------------------------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          ----------------------------------------------------------------------
2crbA1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1kt0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
1w3bA           VHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYTHADSLNNLANIKR
1ya0A1          HGHVYLSKSLEKLSPLREKL---------------------EEQFKELLFQKAF---NSQQLVHVTVINL
1omxA           ----------------------------------------------------------------------
1qsaA1          EWRYWQADLLLERGREAEAKEILHQLMQQRGFYPMVAAQRIGEEYELKIDKAPQNVDSALTQMARVRELM
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           LNRLENLLGNGKYHSDWISNANKVRV--IYWQMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQI
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1b89A           ---------------------------------------------LNDLLXVLSPRLDHTRA---VNYFS
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          --------------------------------------------------------------------ST
2fezA2          ----------------------------------------------------------------------
2crbA1          -------------------------------------------------------------------RLL
1a87A           ----------------------------------------------------------------------
1kt0A1          --------------------------------------------------------------------YL
3ck7A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1nznA           ----------------------------------------------------------------------
2fsqA1          ----------------------------------------------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           -----------------------------------------------------NPXEEGLSXLKLANLAE
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
1xnfA           -------------------------------------------------------------------LYD
1zbpA1          ----------------------------------------------------------------------
2cfuA2          -----------------------------------------------------------ERLLEQARASY
1ihgA1          ------------------------------------------------------------------ACKL
1ihgA1          KAIQAELLKVKQKIK-------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           -------------------------------------------------------------------ELD
1wfdA           ----------------------------------------------------------------------
2fbnA1          ------------------------------------------------------------------TCYN
2ooeA1          -------------------------------------------------------------------YLS
1elrA           ---------------------------------------------------------QAAVYFEKGDYNK
1e96B           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1elwA           ---------------------------------------------------KLDPHNHVLYSNRSAAYAK
2cptA1          ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2fezA2          -------------------------------------------------------------HTAKAEAEI
2crbA1          ----------------------------------------------------------------------
1a87A           -----------------------------------------------------DAIVNAWKQVNAKDMAN
1kt0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           -------------------------------------------------------------------VAY


                         .         .         .         *         .         .         .:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRS
1w3bA           EQGNIEEAVRLYRKALEVFEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLK---
1ya0A1          FQLHHLRDFSNETEQHTYQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLR
1omxA           ----------------------------------------------------------------------
1qsaA1          YWNLDNTARSEWANLVKSKSKTE-QAQLARYAFNNQWWDLSVQATIAGKLWDHLEERF------------
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
1xnfA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1hz4A           LLGEFEPAEIVLEELNENARSNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFIS-----------
2ooeA1          ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
1b89A           KVKQLPLVKPYLRQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAA
1d8dA           ----------------------------------------------------------------------
1elwA           ----------------------------------------------------------------------
1q7sA           ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2pqnA1          DVNDERLGVKILTDIYKEAESRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVED---
2fezA2          ----------------------------------------------------------------------
2crbA1          AAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKRE-----------
1a87A           ----------------------------------------------------------------------
1kt0A1          KLREYTKAVECCDKALGLDANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNE
3ck7A1          ----------------------------------------------------------------------
2c2lA1          -----ERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRK-------------
1nznA           ----------------------------------------------------------------------
2fsqA1          ----------------------------------------------------------------------
1zu2A1          ----------------------------------------------------------------------
1hxiA           AALAFEAVCQK------EPEREEAWRSLGLTQAENEKDGLAIIALNHARXLDPKDIAVHAALAVSHTNE-
1fchA           ----------------------------------------------------------------------
1tjcA           ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
1xnfA           SLGLRALARNDFSQALAIRPDXEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIAL----
1zbpA1          --GQLQQALELLIEAIKASKDASLRSSFIELLCIDGDFERADEQLXQSIKLFPEYLPGASQLRHLVKAAQ
2cfuA2          ARGEYRWVVEVVNRLVFAEDNRAARELQADALEQLGYQAENAGWRNAAYELRHGVPRD------------
1ihgA1          KMSDWQGAVDSCLEALEIDPNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQ-----------
1ihgA1          ----------------------------------------------------------------------
1ouvA           --------------------DPKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQ----
1wfdA           AESRYQQALVCYQEGIDMLLVLKGTKESSKRCVLRTKISGYMDRAENIKKYLD-----------------
1wfdA           ----------------------------------------------------------------------
2fbnA1          KNKDYPKAIDHASKVLKIDNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVN---
2ooeA1          HLNEDNNTRVLFERVLTSGSLGEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEGKETALLVDRYKF
1elrA           CRELCEKAIEVGRENREDYQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKI---
1e96B           ---------------------------SMKSEPRHSKIDKAMECVWKQKLYEPVVIPVG-----------
1d8dA           --------------FLSLDPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQ---
1elwA           KGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA---
2cptA1          -------------------QKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQDRA
2pqnA1          ----------------------------------------------------------------------
2fezA2          ACGRASAVIAELEALTFEHYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRA----
2crbA1          ----------------------------------------------------------------------
1a87A           KIGNLGKAFKVADLAIKVEKEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVT---
1kt0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1tjcA           TEADYYHTELWMEQALRQLDEVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEY---


                         .         +         .         .         .         .         *:700
query           EKIKxxxxxx
1w3bA           ----------
1ya0A1          PR--------
1omxA           ----------
1qsaA1          ----------
1xhbA2          ----------
1h7lA           ----------
2dm9A1          ----------
1xnfA           ----------
1zbpA1          ----------
2cfuA2          ----------
2bo4A1          ----------
1ihgA1          ----------
1ouvA           ----------
1wfdA           ----------
2fbnA1          ----------
1hz4A           ----------
2ooeA1          ----------
1elrA           ----------
1e96B           ----------
1b89A           YLFK------
1d8dA           ----------
1elwA           ----------
1q7sA           ----------
2cptA1          ----------
2pqnA1          ----------
2fezA2          ----------
2crbA1          ----------
1a87A           ----------
1kt0A1          RDRR------
3ck7A1          ----------
2c2lA1          ----------
1nznA           ----------
2fsqA1          ----------
1zu2A1          ----------
1hxiA           ----------
1fchA           ----------
1tjcA           ----------
1a17A           ----------
1xnfA           ----------
1zbpA1          AR--------
2cfuA2          ----------
1ihgA1          ----------
1ihgA1          ----------
1ouvA           ----------
1wfdA           ----------
1wfdA           ----------
2fbnA1          ----------
2ooeA1          MD--------
1elrA           ----------
1e96B           ----------
1d8dA           ----------
1elwA           ----------
2cptA1          EKLK------
2pqnA1          ----------
2fezA2          ----------
2crbA1          ----------
1a87A           ----------
1kt0A1          ----------
2c2lA1          ----------
1hxiA           ----------
1tjcA           ----------