[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50036.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v4aA1.bssp"
#ERROR : Can't open dsspfile "1d5yA2.bssp"
#ERROR : Can't open dsspfile "1bl0A2.bssp"
#ERROR : Can't open dsspfile "1sfnA.bssp"
#ERROR : Can't open dsspfile "1bl0A1.bssp"
#ERROR : Can't open dsspfile "1y9qA2.bssp"
#ERROR : Can't open dsspfile "2pytA1.bssp"
#ERROR : Can't open dsspfile "1zz6A2.bssp"
#ERROR : Can't open dsspfile "1sq4A.bssp"
#ERROR : Can't open dsspfile "1vj2A.bssp"
#ERROR : Can't open dsspfile "3bu7A1.bssp"
#ERROR : Can't open dsspfile "1pmiA.bssp"
#ERROR : Can't open dsspfile "1ey2A.bssp"
#ERROR : Can't open dsspfile "1zrrA1.bssp"
#ERROR : Can't open dsspfile "1xjaA.bssp"
#ERROR : Can't open dsspfile "1qwrA.bssp"
#ERROR : Can't open dsspfile "1yfuA1.bssp"
#ERROR : Can't open dsspfile "2f4pA1.bssp"
#ERROR : Can't open dsspfile "1lr5A.bssp"
#ERROR : Can't open dsspfile "1j1lA.bssp"
#ERROR : Can't open dsspfile "1o4tA.bssp"
#ERROR : Can't open dsspfile "1rc6A.bssp"
#ERROR : Can't open dsspfile "1j58A.bssp"
#ERROR : Can't open dsspfile "1gqgA.bssp"
#ERROR : Can't open dsspfile "1bl0A1.bssp"

## Summary of PDB Search
:240
    1e-16  10%  1v4aA1 [a.24.16.4] GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE
    8e-11  25%  1d5yA2 [a.4.1.8] ROB TRANSCRIPTION FACTOR A:57 -- 121
    8e-11  22%  1bl0A2 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
    3e-09  13%  1sfnA  [b.82.1.11] CONSERVED HYPOTHETICAL PROTEIN
    2e-08  22%  1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
    9e-08  11%  1y9qA2 [b.82.1.15] TRANSCRIPTIONAL REGULATOR, HTH_3 FAMILY A:83
    1e-06  15%  2pytA1 [b.82.1.24] ETHANOLAMINE UTILIZATION PROTEIN EUTQ A:100 --
    1e-06  16%  1zz6A2 [b.82.1.10] HYDROXYPROPYLPHOSPHONIC ACID EPOXIDASE A:77 --
    2e-06  14%  1sq4A  [b.82.1.11] GLYOXYLATE-INDUCED PROTEIN
    2e-06  20%  1vj2A  [b.82.1.10] NOVEL MANGANESE-CONTAINING CUPIN TM1459
    2e-06  14%  3bu7A1 [b.82.1.23] GENTISATE 1,2-DIOXYGENASE A:19 -- 373
    3e-06  12%  1pmiA  [b.82.1.3] PHOSPHOMANNOSE ISOMERASE
    5e-06  15%  1ey2A  [b.82.1.4] HOMOGENTISATE 1,2-DIOXYGENASE
    9e-05  18%  1zrrA1 [b.82.1.6] E-2/E-2' PROTEIN A:1 -- 179
    1e-04  16%  1xjaA  [b.82.4.1] ARABINOSE OPERON REGULATORY PROTEIN
    2e-04   9%  1qwrA  [b.82.1.3] MANNOSE-6-PHOSPHATE ISOMERASE
    2e-04  16%  1yfuA1 [b.82.1.20] 3-HYDROXYANTHRANILATE-3,4-DIOXYGENASE A:1 -- 174
    2e-04  20%  2f4pA1 [b.82.1.9] HYPOTHETICAL PROTEIN TM1010 A:2 -- 135
    3e-04  21%  1lr5A  [b.82.1.2] AUXIN BINDING PROTEIN 1
    4e-04  16%  1j1lA  [b.82.1.12] PIRIN
    4e-04  18%  1o4tA  [b.82.1.9] PUTATIVE OXALATE DECARBOXYLASE
    5e-04   9%  1rc6A  [b.82.1.11] HYPOTHETICAL PROTEIN YLBA
    7e-04  14%  1j58A  [b.82.1.2] YVRK PROTEIN
    8e-04  14%  1gqgA  [b.82.1.5] QUERCETIN 2,3-DIOXYGENASE
    1e-04  21%  1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)(query 189->237)
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNE
1v4aA1          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1sfnA           --------------------TESVYQRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDAR
1bl0A1          ----------------------------------------------------------------------
1y9qA2          --------------------HALGVIEYIHVLEGIXKVFFDEQWHELQQGEHIRFFSDQPHGYAAVTEKA
2pytA1          -QDGSSXAAGFXQWDNAFFPWTLNYDEIDXVLEGELHVRHEGETXIAKAGDVXFIPKGSSIEFGTPTSVR
1zz6A2          --------------------KFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTG
1sq4A           --------------------QDPNAEAVLFVVEGELSLTLQGQVHAXQPGGYAFIPPGADYKVRNTTGQH
1vj2A           --------------------HSHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSE
3bu7A1          --------------------HRHTGNVIYNVAKGQGYSIVGGKRFDWSEHDIFCVPAWTWHEHCNTQERD
1pmiA           ----------------KQVIEGLNGPSIVIATNGKGITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQ
1ey2A           --------------------FYNSDGFLIVPQKGNLLIYTEFGKXLVQPNEICVIQRGXRFSIDVFEETR
1zrrA1          --------------------HTHGEDEVRFFVEGAGLFGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPN
1xjaA           --------------------LGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAR
1qwrA           -----------------AEXAQDESFLICSVIEGSGLLKYEDKTCPLKKGDHFILPAQXPDFTIKGTCTL
1yfuA1          --------------------HDDPLEEFFYQLRGNAWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGS
2f4pA1          --------------------HSHPGGQILIVTRGKGFYQERGPARILKKGDVVEIPPNVVHWHGAAPDEE
1lr5A           --------------------HRHSCEEVFTVLKGKGTLLMGPQEIPFFQNTTFSIPVNDPHQVWNSDEHE
1j1lA           ------------------QPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKH
1o4tA           --------------------HKHEGEFEIYYLLGEGVFHDNGKDVPIKAGDVCFTDSGESHSIENTGNTD
1rc6A           --------LSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPVKKGDYIFMGAYSLQAGYGVAFSY
1j58A           --------------------HWHKEAEWAYXIYGSARVKGRSFIDDVGEGDLWYFPSGLPHSIQALEEGA
1gqgA           ---------------------SFPGACAFQVQEGRVVVQIGDYAATELGSGVAFIPGGVEFKYYSEAYFS
1bl0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNPSLHDLFRYASRLLYNFDQPV
1v4aA1          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1sfnA           VSVFEKPYQTVE-------GVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGA
1bl0A1          ----------------------------------------------------------------------
1y9qA2          VFQNIV----------------------------------------------------------------
2pytA1          FLYVAWPAN-------------------------------------------------------------
1zz6A2          SAKLIA----------------------------------------------------------------
1sq4A           TRFHWI----------------------------------------------------------------
1vj2A           VEFLCL----------------------------------------------------------------
3bu7A1          DACLFS----------------------------------------------------------------
1pmiA           DQDFTT----------------------------------------------------------------
1ey2A           GYILEVGVHFELPDLGPIGANGLANPRDFLIPIAWYLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFXVIN
1zrrA1          FTAIRI----------------------------------------------------------------
1xjaA           EWYHQW----------------VYFRPRAYWEWLNWPSIFANTGFFRPDEAFSDLFGQIINAG-------
1qwrA           IVSH------------------------------------------------------------------
1yfuA1          ACLVIERQRPAGM---------------------------------------------------------
2f4pA1          LVHIGIQVHLGPAEWLGSVTEEEYRKATE-----------------------------------------
1lr5A           DLQVLV----------------------------------------------------------------
1j1lA           FVLIA-----------------------------------------------------------------
1o4tA           LEFLAV----------------------------------------------------------------
1rc6A           IYSKDC----------------------------------------------------------------
1j58A           EFLLVF----------------------------------------------------------------
1gqgA           KVLFVSSGSDGLDQNLVNGEEWSSVSFPADW---------------------------------------
1bl0A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
1v4aA1          -REPSLQSRSLLPTLSAIAELHLLSENDAEQLRVAYLFLRRLENLLQSINDEQTQTLPSDELNRARLAWA
1d5yA2          ------------------------------------------------RLSKSAVALRLTARPILDIALQ
1bl0A2          ------------------------------------------------KMTEIAQKLKESNEPILYLAER
1sfnA           SLPYAEVHYME-----------------------------------------------------------
1bl0A1          -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIR------------------------
1y9qA2          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------
1vj2A           ----------------------------------------------------------------------
3bu7A1          ----------------------------------------------------------------------
1pmiA           ----------------------------------------------------------------------
1ey2A           SVAFDHADPSIFTVLTAKSV--------------------------------------------------
1zrrA1          ----------------------------------------------------------------------
1xjaA           ----------------------------------------------------------------------
1qwrA           ----------------------------------------------------------------------
1yfuA1          ----------------------------------------------------------------------
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------------
1j1lA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1rc6A           ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------
1gqgA           ----------------------------------------------------------------------
1bl0A1          ------------------------------------------------TIHSILDWIEDSPLSLEKVSER


                         .         .         .         +         .         .         .:280
query           VGYEQQSSLARLFRQKEGMSASDYRKAFQx
1v4aA1          XDFADWPQLTGALTAHXTNVRRVFNELI--
1d5yA2          YRFDSQQTFTRAFKKQFAQTPALYRRSPE-
1bl0A2          YGFESQQTLTRTFKNYFDVPPHKYRMTNM-
1sfnA           ------------------------------
1bl0A1          ------------------------------
1y9qA2          ------------------------------
2pytA1          ------------------------------
1zz6A2          ------------------------------
1sq4A           ------------------------------
1vj2A           ------------------------------
3bu7A1          ------------------------------
1pmiA           ------------------------------
1ey2A           ------------------------------
1zrrA1          ------------------------------
1xjaA           ------------------------------
1qwrA           ------------------------------
1yfuA1          ------------------------------
2f4pA1          ------------------------------
1lr5A           ------------------------------
1j1lA           ------------------------------
1o4tA           ------------------------------
1rc6A           ------------------------------
1j58A           ------------------------------
1gqgA           ------------------------------
1bl0A1          SGYSK-WHLQRMFKKETGHSLGQYIRS---