[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50103.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:254
    2e-13  12%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    7e-08  12%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    4e-07  16%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-05  13%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:254

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxNQYIIPPPTKVLQTALDLTASGILLKHITISLYRVFAGFLLTVL
2r6gG1          -----------------------------------LALGFSVITPPPFPVLLWLWNSVKVAGISAIGIVA
2onkC1          --------------------------VAATVTLQLFNFDEFLKAASDPAVWKVVLTTYYAALISTLIAVI
3dhwA1          -------------------------------------------------LVRGVWETLAMTFVSGFFGFV
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FAFPLAILVGINQRLAPYIDPVLDFLGHXXXXXXXXXXXXWFGIGETSKLAVIILATFFPVFLNTLNGIL
2r6gG1          LSTTCAYAFARMRFIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFE
2onkC1          FGTPLAYILARKSFPGKSVVEGILLVVFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKEGFA
3dhwA1          IGLPVGVLLYVTRPGQIIANAKLYRTVLLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALL
1tluA           -------------------------------------------------LGRHLVAEFYECDREVLDNVQ


                         +         .         .         .         .         *         .:210
query           GCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIGYMIIDAEQL
2r6gG1          TIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYQQYLNPQNY
2onkC1          SVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIAPTLIYERYLSEGLSA
3dhwA1          EIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLI----TLVGYSAMGGAVGAG---------
1tluA           LIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVISESHLTIHTWPEYGYAAIDLFTCGED--------


                         .         .         .         +         .         .         .:280
query           SRPDIIIVGILTIGLFGYIIDYCFFKLTNHLIPWAGKxxxxxxx
2r6gG1          LWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVK-------
2onkC1          AMPVAAILILLSLAVF----------------------------
3dhwA1          --------------------------------------------
1tluA           --------------------------------------------