[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50272.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1tv7A.bssp"
#ERROR : Can't open dsspfile "2h7aA1.bssp"

## Summary of PDB Search
:198
    2e-11  24%  1tv7A  [c.1.28.3] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    3e-05  13%  2h7aA1 [d.350.1.1] HYPOTHETICAL PROTEIN YCGL A:2 -- 110
:198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCG
1tv7A           --------------LRLSVTDRCNFRCDYCMPKEVFGDDFVLPKNELLTFDEMARIAKVYAELGVKKIRI
2h7aA1          --------------PKPGILKSKSMFCVIYRSSKRDQTYLYVE--KKDDFSRVPEELMFGQPQLAMILPL


                         .         .         *         .         .         .         .:140
query           YGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICR
1tv7A           GGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYD--AGL-RRINVSLDAIDDTLFQSINN
2h7aA1          DGRKKLVNADIEKVKQALTEQGYY-LQLPPPP--------------------------------------


                         +         .         .         .         .         *         .:210
query           PADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIExxxxxxxxxxxxxxxxxxxx
1tv7A           RNIKATTILEQIDYATS---IGLNVKVNVVIQKGINDD--------------------
2h7aA1          ----------------------------------------------------------