[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50573.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qzwA2.bssp"
#ERROR : Can't open dsspfile "1uf2A.bssp"
#ERROR : Can't open dsspfile "1wruA2.bssp"
#ERROR : Can't open dsspfile "2ffhA2.bssp"
#ERROR : Can't open dsspfile "1mfqC.bssp"
#ERROR : Can't open dsspfile "1f3uA.bssp"
#ERROR : Can't open dsspfile "1wgwA.bssp"
#ERROR : Can't open dsspfile "2z1aA2.bssp"
#ERROR : Can't open dsspfile "1ffhA1.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "1j8mF1.bssp"
#ERROR : Can't open dsspfile "1gg4A4.bssp"
#ERROR : Can't open dsspfile "1a82A.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1ftsA1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1o94D.bssp"
#ERROR : Can't open dsspfile "1f48A1.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1pvdA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1rz3A.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1gvnB.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "1ltqA2.bssp"
#ERROR : Can't open dsspfile "1ujnA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"
#ERROR : Can't open dsspfile "1xjcA.bssp"
#ERROR : Can't open dsspfile "1qexA.bssp"
#ERROR : Can't open dsspfile "1w5sA2.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1oltA.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "1rj9A1.bssp"

## Summary of PDB Search
:446
    5e-42  31%  1qzwA2 [a.36.1.1] SIGNAL RECOGNITION 54 KDA PROTEIN A:295 -- 432
    1e-36  14%  1uf2A  [e.28.1.2] CORE PROTEIN P3
    2e-34  14%  1wruA2 [b.106.1.1] 43 KDA TAIL PROTEIN A:3 -- 176
    2e-34  48%  2ffhA2 [a.36.1.1] PROTEIN (FFH) A:319 -- 418
    1e-32  35%  1mfqC  [a.36.1.1] SIGNAL RECOGNITION PARTICLE 54KDA PROTEIN
    1e-31  26%  1f3uA  [b.65.1.1] TRANSCRIPTION INITIATION FACTOR IIF, BETA
    8e-26  29%  1wgwA  [a.24.13.1] 'SIGNAL RECOGINITION PARTICLE 54
    6e-24  13%  2z1aA2 [d.159.1.2] 5'-NUCLEOTIDASE A:28 -- 329
    9e-22  45%  1ffhA1 [a.24.13.1] FFH A:2 -- 88
    4e-21  56%  1dulA  [a.36.1.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    4e-20  27%  1j8mF1 [a.24.13.1] SIGNAL RECOGNITION 54 KDA PROTEIN F:3 -- 86
    3e-19  19%  1gg4A4 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:99
    6e-19  16%  1a82A  [c.37.1.10] DETHIOBIOTIN SYNTHETASE
    3e-18  18%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    4e-16  17%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    6e-16  56%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    4e-15  22%  1ftsA1 [a.24.13.1] FTSY A:201 -- 284
    7e-15  16%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-12  15%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    2e-11  18%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    3e-11  12%  1o94D  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT
    5e-08  28%  1f48A1 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:1 -- 296
    1e-07  24%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    2e-07  14%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-07  21%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    7e-07  15%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-06  13%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    5e-06  10%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    6e-06  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-05  13%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-05  22%  1pvdA1 [c.31.1.3] PYRUVATE DECARBOXYLASE A:182 -- 360
    3e-05  16%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    4e-05  35%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    5e-05  35%  1g3uA  [c.37.1.1] THYMIDYLATE KINASE
    5e-05  36%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    5e-05  26%  1rz3A  [c.37.1.6] HYPOTHETICAL PROTEIN RBSTP0775
    8e-05  16%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-04  21%  1gvnB  [c.37.1.21] ZETA
    1e-04  22%  1cp2A  [c.37.1.10] NITROGENASE IRON PROTEIN
    1e-04  22%  1ltqA2 [c.37.1.1] POLYNUCLEOTIDE KINASE A:1 -- 152
    1e-04  10%  1ujnA  [e.22.1.1] DEHYDROQUINATE SYNTHASE
    2e-04  29%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-04  40%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    2e-04  10%  1qhbA  [a.111.1.2] HALOPEROXIDASE
    3e-04  25%  1xjcA  [c.37.1.10] MOBB PROTEIN HOMOLOG
    4e-04  23%  1qexA  [b.32.1.1] PROTEIN (BACTERIOPHAGE T4 GENE PRODUCT 9 (GP9))
    4e-04  21%  1w5sA2 [c.37.1.20] ORC2 A:7 -- 293
    5e-04  36%  1e2dA  [c.37.1.1] THYMIDYLATE KINASE
    5e-04  23%  1oltA  [c.1.28.2] OXYGEN-INDEPENDENT COPROPORPHYRINOGEN III
    6e-04  30%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    6e-04  25%  1rj9A1 [a.24.13.1] SIGNAL RECOGNITION PROTEIN A:27 -- 95
:446

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
1qzwA2          ----------------------------------------------------------------------
1uf2A           -----RRRVDNTSYTDSLSDMFNGLRSISSSEFVRSVNGRSVFTEGRIDAIKVNMRAKFDLQFITEGYSK
1wruA2          --------------------TVTLRADGRLFTGWTSVSVTRSIE---SVAGYFELGVNVPPGTDLSGLAP
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
1wgwA           ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
2z1aA2          ----------------------------------------------------------------------
1ffhA1          -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1dulA           ----------------------------------------------------------------------
1j8mF1          ----LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
1gg4A4          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1w36D1          ------GELQNWEECLLASQAVSRGDEPTPMIGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTL
1ffhA2          ----------------------------------------------------------------------
1ftsA1          -LLKTKENLGSGFISLFRGKKIDDD----LFEELEEQLLIADVGVETTRKIITNLTEGASRKQL----RD
1eg7A           -------------------------------------------------EIAQAAKMKPVME-LARGLGI
1f48A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1o94D           ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1cr0A           -------------------------------------------------------------ERIREHLSS
1grqA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1ltqA2          ----------------------------------------------------------------------
1ujnA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhbA           -----------------------------------------------------------DVLVELSSILD
1xjcA           ----------------------------------------------------------------------
1qexA           ----------------------------------------------------------------------
1w5sA2          ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1rj9A1          -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRASG-----------


                         .         .         *         .         .         .         .:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
1qzwA2          ----------------------------------------------------------------------
1uf2A           PPNVKKLMFSDFLSFLDSH--KSDYRPPLLTVPITIGLNNLGETNSNTLRMRSEAIDEYFSSYVGAQILV
1wruA2          GKKFTLEIGGQIVCTGYIDSRRRQM----TADSMKITVAGRDKTADLIDCAAVYSWKNRTLEQIARDLCA
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
1wgwA           RKMIQHAVFKELVKVKVYSG--------------------------------------------------
2z1aA2          ----------------------------------------------------------------------
1ffhA1          AEVILATVYEALKEALGG----------------------------------------------------
1dulA           ----------------------------------------------------------------------
1j8mF1          REWFIKIVYDELSNLFGG----------------------------------------------------
1gg4A4          ----------------------------PARVVALTG--SSGKTSVKEXTAAILSQCGNTLYTAGNLNND
1a82A           -------------------------------RYFVTGTDEVGKTVASCALLQAAKAAGYRTAGYKPVASG
1bifA1          -----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPT-----REFN
1w36D1          DKLF------PVSDEINWQKVAAAVALTRR-ISVISGGPGTGKTTTVAKLLAALIQMADGCRIRLAAPTG
1ffhA2          ---------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
1ftsA1          AEALYGLLKEEMGEILAK----------------------------------------------------
1eg7A           QEDEVELYGKYKAKISLDVYRRLKDKPLILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSL
1f48A2          -----------------------DIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAA
1odfA           -----KTVLDYTIEFLDKYIPEFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEGEKSIGYASIDDFY
1o94D           ----------------------------------------------------------------------
1f48A1          ---------------------------NIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPAS
2p67A1          ----------------------------NTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSN
1e2hA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYLGASETI
1yr6A1          -------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVK
1cr0A           EESVGLL--------FSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEES
1grqA           -----------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEPL
1oftA           -------------------------------SELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPA
1nijA1          ----------------------------PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVS
1lw7A2          ------------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEK
1pvdA1          -------------------QTPIDMSLKPND--------AESEKEVIDTILALV-KDAKNPVILADCCSR
2v3jA1          ----------------------LTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGL-----------
1ckeA           ----------------------------IAPVITIDGPSGAGKGT----LCKAMAEALQWHLLDSGAIYR
1g3uA           -------------------------------LIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLA-----
4tmkA           -------------------------------YIVIEGLEGAGKTTARNVVVETLEQLGIRDMVF------
1rz3A           ----------------------LAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHXDDH-
1e3mA2          ----ITEGRHPVVEQVLNEPFNPLNLSPQRRXLIITGPNXGGKSTYXRQTALIA----------------
1gvnB           --QFENRLNDNLEELIQGKKA-----VESPTAFLLGGQPGSGKTSLR---SAIFEETQGNVIVIDNDTFK
1cp2A           -------------------------------QVAIYGKGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKA
1ltqA2          -------------------------------IILTIGCPGSGKST----WAREFIAKNPGFYNINRDDYR
1ujnA           ----------------------------------------------EGVLKEV-PPLAGPAALLFDRRVE
1q3tA           -----------------------------TIQIAIDGPASSGKST----VAKIIAKDFGFTYLDTGAMYR
1e6cA           -----------------------------TEPIFMVGARGCGMTTVGRELARAL----------------
1qhbA           DSASSNE-KQNIADGDVSPGKSFLLPMAFAEGSPFHPSYGSGHAVVAGACVTILKAFFDANFQVFEVDTD
1xjcA           -------------------------------VWQVVGYKHSGKTTLXEKWVAAAVREG----------WR
1qexA           -----------------------------------------------------------------GQKES
1w5sA2          --EAEALARIYLNRLLSGAGLSVNM------IYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYA
1e2dA           -------------------------------LIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL------
1oltA           ----------------------------------------------------------------------
2bdtA1          -------------------------------LYIITGPAGVGKSTTCKRLAAQLDNSA----YIEGDIIN
1rj9A1          RKDLKEAVKEKLVGMLEPDERKLGFNPQKP----------------------------------------


                         +         .         .         .         .         *         .:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
1qzwA2          ----------------------------------------------------------------------
1uf2A           PINVVDTRVYTSELRNFFTGDVVIRDPFDVWDGVKAYIPIGVHGVRLDPNGD------------------
1wruA2          PYGVTVRWELSDKESSAAFPGFTLDHSETVYEALVRASRARGVLMTSNAAGELVF---------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1f3uA           -AERGELDLTGAKQNTGVWLVK--VPKYLSQQWAKAGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIG
1wgwA           ----------------------------------------------------------------------
2z1aA2          -----------------------LDPYESAQKAVYELLAKGVNKIVVLSHLGYGEDLKLARRLVGVQVIV
1ffhA1          ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1j8mF1          ----------------------------------------------------------------------
1gg4A4          IGVPXTLLRLTPEYDYAVIELGANHQGEI----AWTVSLTRPEAALVNNLASL---AGVAKAKGEIFSGL
1a82A           SEKTPEGLRNSDALALQRNSSLGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQE
1bifA1          VGQYRR-DMVKTYKSFEFFLPDNEEGLKIRKQCALALSEEGGHVAVFDATNTTRERRAMIFNFGEQ----
1w36D1          KAAARLTESLGKALRQLPLTDRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPSRLIDALPDHRDQL
1ffhA2          PAAREQLRLLGEKVGVPVEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
1ftsA1          ----------------------------------------------------------------------
1eg7A           GP--------------------------------------------------------------------
1f48A2          HLNNLQVSRIDPHEETERY--RQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAG---
1odfA           LTHEDQLK-LNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEDRCPTGQKIK
1o94D           --LIGAANGLKKSGEDKVAVIGSQ-----ADAFVPALSVNGVDELVVKGSSIDFDPDVFEASVSALIAAH
1f48A1          NVGQVFSQTIGNTIQ-------------------------------------------------------
2p67A1          DLARA------EAAFIRPVPSGASQRARELMLLCEAA---GYDVVIVETVGVGQSETEVAR---------
1e2hA           ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALL
1yr6A1          ELPYEPSI--------------------------------------------------------------
1cr0A           VEETAELIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGL
1grqA           KMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVLWVGVR
1oftA           SLTHEWLRRAGLNRE--RILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPL-----SRAARKQLSRAA
1nijA1          VDDIKTLTNGCICCS--RSNELEDALLDLLDNLDKGNI--QFDRLVIECTGMADPGPIIQTFHEVLCQRY
1lw7A2          LGGDEQAMQYSDYPQXALGHQ-------------------------------------------------
1pvdA1          HDVKAETKKLIDLTQFPAFVTPM-----------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ckeA           VLALAALH--------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1gvnB           QQNFDELVKLYEKDVVKHV----TPYSNRMTEAIISRLSDQGYNLVIEGTGR------------------
1cp2A           DSTRLLLGGLAQKSVLDTLREEGEDV--------------------------------------------
1ltqA2          QSIXAHEERDYTKKKEGIVTGXQFD---TAKSILYGGDSV-KGVIISDT----NLNPERRLAWET-----
1ujnA           GFAQEVAKALGVR-HLLGLPGGEAAKLEVYGKVLSWLAEKGLPRNA------------------------
1q3tA           AATYMALK--------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhbA           EDKLVKSSFPGPLTVAGELNKLADNVIGRNMAGVHYFSDQFESLLLGEQIAIGILEEQSLT---------
1xjcA           VGTVKATAVEGDGL----LQLHLRRPLWRLDDVLALYAPLRLDLVLV-----------------------
1qexA           PAEGTWNISTSGSVDIPLFHRTEYNMAKLCQSVDGRKIKTAEINILVDTNSEVISSETEEDEIANIAFSI
1w5sA2          PNLYTILSLIVRQTGYPI-QVRGAPALDILKALVDNLYVENHYLLVIEFQSMLSSPRIAAEDLYTL---L
1e2dA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------------
2bdtA1          HXVVG-----------------------------------------------------------------
1rj9A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
1qzwA2          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
1wruA2          ----------------------------------------------------------------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1f3uA           APREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRP----------------------------
1wgwA           ----------------------------------------------------------------------
2z1aA2          GHSHTLLGSFPHKELSPAGPYPTVVKNPEGKDVLVVQAWEWGKV--------VGLLEVTFDAKGELLA-Y
1ffhA1          ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1j8mF1          ----------------------------------------------------------------------
1gg4A4          PENGI-----------------------------------------------------------------
1a82A           QLPVILVVGVKLGCINHAMLTVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEI------
1bifA1          NGYKTFFV--------------------------------------------------------------
1w36D1          ASVEAGAVLDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQ----------------
1ffhA2          GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEP-----
1ftsA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1f48A2          --KRFVVMDTAPTGHLLLDATTPMM---------------------------------------------
1odfA           LPVDIFILEGWFLGFNPI-LQGIENNDLLTGDMVDVNAKLFFRNPEIKSLGIVFTTDKVGKGMTDEMPSY
1o94D           NPSVVLLPHSVDSLGYASSLASKTGYGFATDVY-----IVEYQGDELVATRGGYQKVNVEVDFPGKSTVV
1f48A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e2hA           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP-------------------------------
1yr6A1          ----------------------------------------------------------------------
1cr0A           GCD--VIILDHISIRKMITKLKGFAKSTGVVLVVICHL--------------------------------
1grqA           CDGAVAEGRETARGDRVAGMAYVVHEGVEYDVEVDT----------------------------------
1oftA           QLGQAQSLN-------------------------------------------------------------
1nijA1          LLDGVIALVDAVHADEQMNQFTIAQSQVGYADRILLTKTDVAGEAEKLHRLARINARAPVYTVTHGDIDL
1lw7A2          ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1ltqA2          ----------------------------------------------------------------------
1ujnA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1xjcA           ----------------------------------------------------------------------
1qexA           KENYVTATISSSTVGMRAAVKVIATQKIG-----------------------------------------
1w5sA2          RVHEEIPSRDGVNRIGFLLVASDVRALSYMR---------------------------------------
1e2dA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------DVLDHL
2bdtA1          ----------------------------------------------------------------------
1rj9A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
1qzwA2          ---------------GDIESILEKVKGLEEYDKIQKKMEDVMEGKLTLRDVYAQIIALRKMGPLSKVLQH
1uf2A           ----------------------------------------------------------------------
1wruA2          ----------------------------------------------------------------------
2ffhA2          --------------------------------------------ELSLEDFLKQMQNLKRLGPFSEILGL
1mfqC           -----------------------------------------KHGQFTLRDMYEQFQNIMKMGPFSQILGM
1f3uA           ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
2z1aA2          KGEALLMTPEAAPEDFFAKEALLAYAQPVMA---------------------------------------
1ffhA1          ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1j8mF1          ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1a82A           -PWLAENPENAATGKYINLALL------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1ffhA2          --FYPERLAGRILGMG------------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1odfA           KLYLNDFVRSESLGSIATLTLGIDSNRNVYSTKT------------------------------------
1o94D           LTIRPSVFKPLEGAGSPVVSNVDA----------------------------------------------
1f48A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1nijA1          GLLFGFMLEENVVSTKPRFHFIADKQ--------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1ltqA2          ----------------------------------------------------------------------
1ujnA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1xjcA           ----------------------------------------------------------------------
1qexA           ----------------------------------------------------------------------
1w5sA2          ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
1oltA           RAEGFNRLSMGVQDFNKVQRLVNREQ---DEEFIFALLNHAREIGFTPESFAFTLKRVAELNP-DRLYAH
2bdtA1          ----------------------------------------------------------------------
1rj9A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
1qzwA2          IPGLGIMLPTPSEDQLGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNN
1uf2A           ----------------------------------------------------------------------
1wruA2          ----------------------------------------------------------------------
2ffhA2          LPGVPQGLKV------DEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEE
1mfqC           IPGFNE--------QESMARLKKLMTIMDSMNDQELDSTDGAQPGRIQRVARGSGVSTRDVQELLTQYTK
1f3uA           ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
2z1aA2          ----------------------------------------------------------------------
1ffhA1          ----------------------------------------------------------------------
1dulA           --------------FLEQKVLVRXEAIINSXTXKERAKPEIIKGSRKRRIAAGSGXQVQDVNRLLKQFDD
1j8mF1          ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1o94D           ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1pvdA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1gvnB           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1ltqA2          ----------------------------------------------------------------------
1ujnA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1xjcA           ----------------------------------------------------------------------
1qexA           ----------------------------------------------------------------------
1w5sA2          ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
1oltA           LPTIFAAQRKIKDADLPSPQLDILQETIIGMDHFARPDDELAVAQREGVLHR------------------
2bdtA1          ----------------------------------------------------------------------
1rj9A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TRKMMKQISNMxxxxxxxxxxxxxxx
1qzwA2          MNRLLKMV------------------
1uf2A           --------------------------
1wruA2          --------------------------
2ffhA2          MKALMKSLE-----------------
1mfqC           FAQMVKKMGGI---------------
1f3uA           --------------------------
1wgwA           --------------------------
2z1aA2          --------------------------
1ffhA1          --------------------------
1dulA           XQRXXKK-------------------
1j8mF1          --------------------------
1gg4A4          --------------------------
1a82A           --------------------------
1bifA1          --------------------------
1w36D1          --------------------------
1ffhA2          --------------------------
1ftsA1          --------------------------
1eg7A           --------------------------
1f48A2          --------------------------
1odfA           --------------------------
1o94D           --------------------------
1f48A1          --------------------------
2p67A1          --------------------------
1e2hA           --------------------------
1yr6A1          --------------------------
1cr0A           --------------------------
1grqA           --------------------------
1oftA           --------------------------
1nijA1          --------------------------
1lw7A2          --------------------------
1pvdA1          --------------------------
2v3jA1          --------------------------
1ckeA           --------------------------
1g3uA           --------------------------
4tmkA           --------------------------
1rz3A           --------------------------
1e3mA2          --------------------------
1gvnB           --------------------------
1cp2A           --------------------------
1ltqA2          --------------------------
1ujnA           --------------------------
1q3tA           --------------------------
1e6cA           --------------------------
1qhbA           --------------------------
1xjcA           --------------------------
1qexA           --------------------------
1w5sA2          --------------------------
1e2dA           --------------------------
1oltA           --------------------------
2bdtA1          --------------------------
1rj9A1          --------------------------