[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50700.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c82A1.bssp"
#ERROR : Can't open dsspfile "1aipA3.bssp"
#ERROR : Can't open dsspfile "1f60A3.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1darA2.bssp"
#ERROR : Can't open dsspfile "1n0uA2.bssp"
#ERROR : Can't open dsspfile "1g7rA4.bssp"
#ERROR : Can't open dsspfile "1o9nA.bssp"
#ERROR : Can't open dsspfile "1puiA.bssp"
#ERROR : Can't open dsspfile "1eniA.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"
#ERROR : Can't open dsspfile "2hgjF1.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1q4rA.bssp"
#ERROR : Can't open dsspfile "1upsA2.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1nriA.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1sulA.bssp"
#ERROR : Can't open dsspfile "1wb1A4.bssp"
#ERROR : Can't open dsspfile "1mkyA2.bssp"
#ERROR : Can't open dsspfile "1wb1A1.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1lvaA2.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "1jxhA.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "1aipA1.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1darA1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "3ejvA1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1wdtA1.bssp"
#ERROR : Can't open dsspfile "2bmjA1.bssp"
#ERROR : Can't open dsspfile "1g7rA2.bssp"
#ERROR : Can't open dsspfile "1n0uA1.bssp"
#ERROR : Can't open dsspfile "1aipA2.bssp"
#ERROR : Can't open dsspfile "2q22A1.bssp"
#ERROR : Can't open dsspfile "2gtvX1.bssp"
#ERROR : Can't open dsspfile "1p5uB.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1kjzA1.bssp"
#ERROR : Can't open dsspfile "1pujA.bssp"
#ERROR : Can't open dsspfile "1xe1A.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "1g7rA1.bssp"
#ERROR : Can't open dsspfile "1pvwA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1wsuC1.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1bs2A2.bssp"

## Summary of PDB Search
:635
    1e-28  14%  1c82A1 [a.102.3.2] HYALURONATE LYASE A:171 -- 540
    2e-22  37%  1aipA3 [c.37.1.8] ELONGATION FACTOR TU A:9 -- 212
    4e-20  30%  1f60A3 [c.37.1.8] ELONGATION FACTOR EEF1A A:2 -- 240
    1e-19  23%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    2e-19  27%  1darA2 [c.37.1.8] ELONGATION FACTOR G A:1 -- 282
    6e-19  29%  1n0uA2 [c.37.1.8] ELONGATION FACTOR 2 A:3 -- 343
    5e-17  22%  1g7rA4 [c.37.1.8] TRANSLATION INITIATION FACTOR IF2/EIF5B A:1 --
    3e-15   9%  1o9nA  [c.117.1.1] MALONAMIDASE E2
    1e-14  10%  1puiA  [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB
    1e-14   8%  1eniA  [a.18.1.1] ENDONUCLEASE V
    1e-14  11%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
    4e-14  15%  2hgjF1 [c.22.1.1] 50S RIBOSOMAL PROTEIN L4 F:3 -- 208
    6e-14  13%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    1e-13  13%  1q4rA  [d.58.4.4] PROTEIN AT3G17210
    5e-13  11%  1upsA2 [b.42.2.3] GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- A:290
    8e-13  12%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    2e-12  14%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    2e-12  11%  1nriA  [c.80.1.3] HYPOTHETICAL PROTEIN HI0754
    3e-12  15%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-12  15%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    7e-12  12%  1o94C  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    4e-10  16%  1sulA  [c.37.1.8] GTP-BINDING PROTEIN YSXC
    5e-10  30%  1wb1A4 [c.37.1.8] TRANSLATION ELONGATION FACTOR SELB A:1 -- 179
    8e-10  14%  1mkyA2 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:173 -- 358
    9e-10  26%  1wb1A1 [b.43.3.1] TRANSLATION ELONGATION FACTOR SELB A:180 -- 271
    1e-09  15%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    2e-09  41%  1lvaA2 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:438
    1e-08   5%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    1e-08  10%  1jxhA  [c.72.1.2] PHOSPHOMETHYLPYRIMIDINE KINASE
    3e-08  19%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    4e-08  19%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    7e-08  18%  1d1nA  [b.43.3.1] INITIATION FACTOR 2
    7e-08  28%  1aipA1 [b.43.3.1] ELONGATION FACTOR TU A:213 -- 312
    8e-08  18%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    1e-07  44%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    2e-07  19%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    2e-07  16%  1darA1 [b.43.3.1] ELONGATION FACTOR G A:283 -- 400
    4e-07  13%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    5e-07  12%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    5e-07  15%  3ejvA1 [d.17.4.28] UNCHARACTERIZED PROTEIN WITH CYSTATIN-LIKE FOLD
    8e-07  16%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    1e-06  18%  1wdtA1 [b.43.3.1] ELONGATION FACTOR G HOMOLOG A:275 -- 377
    1e-06  14%  2bmjA1 [c.37.1.8] CENTAURIN GAMMA 1 A:66 -- 240
    1e-06  22%  1g7rA2 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:460 --
    1e-06  10%  1n0uA1 [b.43.3.1] ELONGATION FACTOR 2 A:344 -- 481
    3e-06  30%  1aipA2 [b.44.1.1] ELONGATION FACTOR TU A:313 -- 405
    3e-06   8%  2q22A1 [d.365.1.1] UNCHARACTERIZED PROTEIN A:8 -- 138
    4e-06  17%  2gtvX1 [a.130.1.3] CHORISMATE MUTASE X:1 -- 93
    6e-06  24%  1p5uB  [b.2.3.2] F1 CAPSULE ANTIGEN
    7e-06  16%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    9e-06  27%  1kjzA1 [b.43.3.1] EIF2GAMMA A:201 -- 321
    2e-05  20%  1pujA  [c.37.1.8] CONSERVED HYPOTHETICAL PROTEIN YLQF
    2e-05  29%  1xe1A  [b.43.3.1] HYPOTHETICAL PROTEIN PF0907
    4e-05  11%  1ahjB  [b.34.4.4] NITRILE HYDRATASE (SUBUNIT BETA)
    5e-05  18%  1g7rA1 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:228 --
    7e-05  15%  1pvwA  [d.115.1.2] 3,4-DIHYDROXY-2-BUTANONE 4-PHOSPHATE SYNTHASE
    1e-04  19%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-04  26%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    7e-04  42%  1wsuC1 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR C:517
    7e-04  17%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    9e-04  13%  1bs2A2 [c.26.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:136 -- 483
:635

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
1c82A1          ----------------------------DTYTDRLDDWNGIIAGNQDSKNDQMAKLNQELEGKVADSLSS
1aipA3          --HVNVGTIGHVDHGKTTLTAALTYVTA-------AENPTAHVEYET----AKRHYSHVDCPGHADYIKN
1f60A3          --HINVVVIGHVDSGKSTTTGHLIYKVLDKLKAERERGITIDIALWKFETP-KYQVTVIDAPGHRDFIKN
1wdtA2          -----VALVGHAGSGKTTLTEALLYKTTDYTPEAKLHRTTVRTGVAPLLFR-GHRVFLLDAPGYGDFVGE
1darA2          -----IGIAAHIDAGKTTT--------TERILYYTGRAAVTTCFW------KDHRINIIDTPGHVDFTIE
1n0uA2          -----MSVIAHVDHGKSTLTDSLVQSLYSEMSDEDVKEIKQKTDGNSFLI------NLIDSPGHVDFSSE
1g7rA4          -----------------------------EIPXDVIEGICGDFLKKFSIRETLPGLFFIDTPGAFTTLRK
1o9nA           ------------------------GMIPLALGTQTGGSVIRPAAYCGTAAI-KPSFRMLPTVGVKCYSWA
1puiA           -----APDIRHLPSDTGIEVNAGKSSALNTLTNQQLINLFEVDGKRLVDLPGY----GEMKRKWQRALGE
1eniA           ---------------------------------------------------------LTLVSELADQHLM
1vfgA2          --VVRDILLGKEVWDVDFVVEGNAPFPEFGTAHLKIGKLKLEFATA--RRETVEPASLKEDLIRRDFTIN
2hgjF1          --WEVVRWQLRGTASTKTRGEVAYSGKHTGRARHGDIGAPIFVGGGVVFGP-KPRDYSYTLPKKVRKKGL
1nrjB           -YQPSIIIAGPQNSGKTSLLTLLT-------TDSVRPTVVSQEPLSAADYD-GSGVTLVDFPGHVKLRYK
1q4rA           -DGVSPEKIEELIKGYANLVNLIEPWGKDVSIENLHQGYTHI--FESTFESKEAVAEYIAHPAHVEFATI
1upsA2          -----NYLIRNRQTGKFLY--------IEENNDKVSYGITLKNEKNAKWSKTGEYLNIENQTGYIEHGKV
2fh5B1          -----VLFVGLCDSGKTLLFVRLLT---GQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRFQL
1h65A           --ATQTKLLELLGNLKQEDLTILVXIGERVVSISPFQSEGPRPVXVSRSRA-GFTLNIIDTPGLIEGGYI
1nriA           VPLAIESCLPQISLAVEQIVQAFQQLDASECPPTFGVSTEXVKGIIAGGECAIRHPVE-GAEDNTKAVLN
1eg7A           --IAHGCNSIIATKTALKLADYVVTEAGFGADLGAEKFYDVKCRYA------GFKPDATVIV-ATVRALK
1egaA1          -YCGFIAIVGRPNVGKSTLLNKLLGQTSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMN
1o94C           -------------------------------------------------------------AIVVGRILT
1sulA           -GLPEIALAGRSNVGKSSFINSLI-NRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIET
1wb1A4          -KNINLGIFGHIDHGKTTLSKVLTEIAGFSAFKLENYRITL-----------------VDAPGHADLIRA
1mkyA2          -DAIKVAIVGRPNVGKS--------TLFNAILNKERALVSPIPVDDEVFIDGRKYVFVDTAGLEKYSNYR
1wb1A1          ----------------------------------------------------------------------
1zd9A1          -EEMELTLVGLQYSGKTTFVNVIAS---GQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWER
1lvaA2          ----------------------------------------------------------------------
2c31A3          ------NSLGVVRDFMLANPDISLVNEG---------ANALDNTRMIVDMLKPRKRLDSGTWGVMGIGMG
1jxhA           ----ALTIAGTDPSGGAGI-----QADLKTFSALGAYGCSV--ITALVA-ENTCGVQSVYRIEPDFVAAQ
2cxxA1          -----IIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDXPGFGHFIEDNAKNIDVA
1xzpA2          -----MVIVGKPNVGKSTLLNRLLNEDRAIVTRDVISEEIVIRGILFRIVDTAGVRSETNDLVERLGIER
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          --------PLVNAE----IARQVEALLTPNTTVIAETGDSW-FNAQRMKLPNGARVEYEMQWGHIGWSVP
1lvaA4          ----------------------------------------------------------------------
1tpzA           --VLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGTNFPPDT
1darA1          ----------------------------------------------------------------------
1ni3A1          -NNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKVAVPDERFDWLCEADIAGLTKGAST
1um9A           ---------YYRDHGLALLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVAS-PIASHVPPAAGAAI
3ejvA1          ----------------------------------------------------------------------
1lnzA2          -----VGLVGFPSVGKSTLLSVVSSVPNLGXVETDDGRSFVXADLPGLIEGAHQGVGLGHQFLRHIERTR
1wdtA1          ----------------------------------------------------------------------
2bmjA1          IPELRLGVLGDARSGKSSLIHRFLTGSYQ----VLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFS
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ---------------------------------------------------------------MAKARRE
1xe1A           ----------------------------------------------------------------------
1ahjB           -GRPAPVETTTFEVGQRVRVRDEYVPGHIRMPCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYFAA
1g7rA1          ----------------------------------------------------------------------
1pvwA           ---------------------------------------------------RAAEGLVKNRQGHTEMT-V
1mkyA1          -TVLIVG---RPNVGKSTLF--------NKLVKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXKEV
2p67A1          ----------------------------------------------------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
1c82A1          ISSQADRIY-------LWEKFSNYKTSANLTATYRKLEEAKQVTNPSSRYDETVVRTVRDSMEWMHKHVY
1aipA3          MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDVDDPELLDLVEMEVRDLLNEFP
1f60A3          MITGTSQADCAILIIAGGVGEFEAGREHALLAFTLGVRQLIVAVNKMDKWDESRFQEIVKETSNFIKGYN
1wdtA2          IRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPR-MVVVTKLD--KGGDYYALLEDLRSTLGPI-
1darA2          VERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPR-IAFANKMDKTGAD-LWLVIRTMQERLGARP
1n0uA2          VTAALRVTDGALVVVDTIEGVCVQTETV--LRQALGERKPVVVINKVDRALLE-LQVSKEDLYQTFARTV
1g7rA4          RGGAL--ADLAILIVDINEGFKPQTQEALNILRXYRTPF-VVAANKIDRIHGWRVHQVQQKLDTKVYELV
1o9nA           LGLFGARAEDLARGLLAMTGRSEFSGIVPAKAPRIGVVR-QEFAGAVEPAAEQGLQAAIKAAERAGASVQ
1puiA           YLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF--
1eniA           AEYRELPRVFGAVRKHVANGKRVRDFKISPTFI-LGAGHVTFFYDKLEFLRKRQ-----IELIAECLKFN
1vfgA2          AMAISVNLEDYGTLIDYFGGLRDLKD--------------------------------------------
2hgjF1          AMAADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELARNLPWVVTLAPEGLNDIV
1nrjB           LSDYFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDILIACNKSELFTARPPSKIKDALESEIQKVI
1q4rA           FLGSLDKVLVIDYKPTS-----------------------------------------------------
1upsA2          P-KTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESY-----EGVLQYGNVPNTYWTSQWQLIPV------
2fh5B1          LDRFKSSARAVVFVVDSAAFQREVKDVLIDSMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNT--
1h65A           NFLLDKTIDVLLYVDRLDAYRVDNLKAITDSFGKGIWNKAIVALTHAQFSPPDGLP---------YDEFF
1nriA           DLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLG-ALTISIASNPK----------------------
1eg7A           MHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPA-VVAINAFPTDTEAELNLLYELCAKA-----
1egaA1          KAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNKVDNVQEKADLLPHLQFLASQMN--
1o94C           EVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPH---AAVVADLQYKPGDNKAVIRRELEGGMLQEV
1sulA           YITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPV-IVIATKADKIPKGKWDKHAKVVRQTLNIDP
1wb1A4          VVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTIKRTEMIMKSILQSTHN--
1mkyA2          VVDSIEKADVVVIVLDATQGITRQDQRXAGLXER-RGRASVVVFNKWDLVVHREKRYDEFTKLFREKLYF
1wb1A1          ----------------------------------------------------------------------
1zd9A1          YCRGVSAIVYMVDAADQEEASKNELHNLLDKPQLQGIPV-LVLGNKRDLPGALDEKELIEKMNLSAIQD-
1lvaA2          ----------------------------------------------------------------------
2c31A3          YCVAAAAVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGIYGNEADPQPGVISCTRLTRG-
1jxhA           LDSVFSDVRIDTTKIGMLAETDIVEA----VAERLQRHHVRNVVLDTVMLLLSP-SAIETLRVRLLPQVS
2cxxA1          VLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPT-IVAVNKLDKIKNVQ-EVINFLAEKFEVPLS
1xzpA2          TLQEIEKADIVLFVLDASSPLDEEDRKILERIKNKRYL---VVINKVDVVEK----INEEEIKGT-----
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          AAFGYGAPERRNILMVGD-GSFQLTAQEVAQMVRLKLPVIIFLI--------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           YLEKMKFYEYDFFIIISATRF---KKNDIDIAKAISMKEFYFVRTKVDSDKEKVLQDIRLNCVNTFRENG
1darA1          ----------------------------------------------------------------------
1ni3A1          GVGFLSHVRAVDAIYQVVRAFDDAEIIHVE-GDVDPIRDLSIIVDELLIKDAEFVEKHLEGLRKITS---
1um9A           SMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAE--------------------------
3ejvA1          ----------------------------------------------------------------------
1lnzA2          VIVHVIDXSGLEGRDPYDDYLTINQE-LSEYNLRLTERPQIIVANKXD----XPEAAENLEAFKEKLT--
1wdtA1          ----------------------------------------------------------------------
2bmjA1          GWADAVIFVFSLEDENSFQAV---SRLHGQ-LSSLRGRGGLLVGTQDRISASSPRVVGDARARALCAD--
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------NCLDIAPILKPSEKE-SVRRALILITKSDY
2gtvX1          MIEKLAEIRKKIDEIDNKILKARWPWAEKLIAERNSLAK-DVAEIKNQLGDPEREKYIYDRIRKLCKEHN
1p5uB           ----------------------------------------------------------------------
1yr6A1          -----------------------------EKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTEVL
1kjzA1          ----------------------------------------------------------------------
1pujA           VTEKLKLIDIVYELVDARIPMSSR---NPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQ-----
1xe1A           ----------------------------------------------------------------------
1ahjB           EELFGSDTDGGSVVVDLFEGYL------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ALAELANLVTTICEMMGDDGNAMSKNETK-----------------------------------------
1mkyA1          TLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDT-ILVANKAENLRE-------FEREVKPELYS
2p67A1          --------------------------RMVDCFISLQIKKGLIVINKDDGDNHTNVAIARHMYESALHKYD
1wsuC1          ----------------------------------------------------------------------
1iugA           --AWTPAINLVLAVAAVLEEVLPRLEEHLALKAWQNLLYGVGEEGGLRPVPKRFSPAVYARVKEAFAQRG
1bs2A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKLRLPIDRXXXXXXXXXXXXXXXXXXRVSTGD
1c82A1          EIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKVPDPEHFRKTTDN-----PFKALGGNLVDMGRVKVIA
1aipA3          GDEVPVIRGSALLVDKIWELLDAIDEYI------------------------------------------
1f60A3          PKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETK-----------------------------------
1wdtA2          -LPIDLPLYEGGKWVGLIDVFHGKAYRYENGEEREA----------------------------------
1darA2          V---------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          GSQVSIIPISAITGEGIPELLTXLXGL-------------------------------------------
1o9nA           AIDLPEAVHEAWRIHPIIQDFEAHRALAWEFSEH------------------------------------
1puiA           NGDVQVETFSSLKKQGVDKLRQKLDT--------------------------------------------
1eniA           IKDTTVQDIS------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          RTERLVMDLD--AWEVFQNRIG------------------------------------------------
1nrjB           ERRLNELDVLGFKFANLEASVVAFEGSI------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ---LRVTRSPAQLGKKGKEFEFSQ----------------------------------------------
1h65A           SKRSEALLQVVRSGASLKKDAQASDIPVVLIE--------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           --GAEVALSWAKGGEGGLELARKVLQTLESRPSN------------------------------------
1egaA1          --FLDIVPISAETGLNVDTIAAIVRKHLPEATHH------------------------------------
1o94C           EINCPAV---------------------------------------------------------------
1sulA           --EDELILFSSETKKGKDEAWGAIKKMIN-----------------------------------------
1wb1A4          LKNSSIIPISAKTGFGVDELKNLIITTLN-----------------------------------------
1mkyA2          IDYSPLIFTSADKGWNIDRXID------------------------------------------------
1wb1A1          ---------------------------------RNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGD
1zd9A1          -REICCYSISCKEKDNIDITLQWL----------------------------------------------
1lvaA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           LITPNLPEAAALLDAPHARTEQEMLAQGRALLAMGCEA--------------------------------
2cxxA1          EIDKVFIPISAKFGDNIERLKNRIFEVI------------------------------------------
1xzpA2          --DRHMVKISALKGEGLEKLEESI----------------------------------------------
1d1nA           ----------------------------------------------------------------KITRDS
1aipA1          --------------------------------VRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           IAEPPIFLLSNK----------------------------------------------------------
1darA1          -----------------------------------------------------------------LTSGS
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          ----------------------------------------------------------------------
1lnzA2          -DDYPVFPISAVTREGLRELLFEVANQLENTPE-------------------------------------
1wdtA1          --------------------------------ERFGDGPPLAKVFKVQVDPFMGQVAYLRLYRGRLKPGD
2bmjA1          MKRCSYYETCATYGLNVDRVFQEV---AQKVVTLRKQQQL------------------------------
1g7rA2          -----------------------------------------------------------------IRQGY
1n0uA1          ------VTAQAYRAEQLYEGPADDANCIAIK-NCDPKADLMLYVKMVPTSDKGRFYAFGRVFAGTVKSGQ
1aipA2          ----------------------------------------------------------------------
2q22A1          QILGICADTADEGLLAXKTYSHALGYEVPDLPVV------------------------------------
2gtvX1          VDENIGIKI-------------------------------------------------------------
1p5uB           -----------------------------------------------------------------NLVGD
1yr6A1          P-PVRVLYLSAKTREGFEDLETLAYEH-------------------------------------------
1kjzA1          -----------------------------------------------------------------LKVGD
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          -------------------------------------SPARGTILEVKEETGLGXTIDAVIYDGILRKDD
1pvwA           ----------------------------------------------------------------------
1mkyA1          LGFGEPIPVSAEHNINLDTXLETIIK--------------------------------------------
2p67A1          EWQPRVLTCSALEKRGIDEIWHAIIDFKTALTA---SGRLQ-----------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           AVIAGLSLMGAYDRYEALGVAGMFREVLEE----------------------------------------
1bs2A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TVEIMPLGTVSRVRSIQVHGKKVEQARAGQRTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLE
1c82A1          GLLRKDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHTNVATGAYGNVLIDGLSQLLPVIQKTKNDKMQ
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGXILTSKDT---------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           KVRLIRQGIVVYIDSLKRYKDDVREVAQGYECGLTIKN--FNDIKEGDVIEAYVMQE-------------
1aipA1          EVEIVGLAPETRRTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITP------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1darA1          YVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRV------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          ---------------------------ADETIILNVLGQYTRAHDRRDPDAXAALFAPEATIEIVDAVGG
1lnzA2          ----------------------------------------------------------------------
1wdtA1          SLQSEAGQRLPHLYPMGKDLLEVEEAEAGFVLGV----PKAEGLHRGMVLWQGEKPESEEVPFAR-----
2bmjA1          ----------------------------------------------------------------------
1g7rA2          PLXNDDGETVGTVESXQDKGENLKSASRGQKVAXAIKDAYGKTIHEGDTLYVDIPENH------------
1n0uA1          KVRIQGPNYVPGKKDDLFIRFVEPIDDCPAGNIIGLVGI-DQFLLKTGTLTTSETAHNMKVM--------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          EIEIRPGVPYTEIVSLQAGGQFVEEAYPGGLVGVGTKLLTKGDLMAGNVVGKPGKLPP------------
1pujA           ----------------------------------------------------------------------
1xe1A           ---VKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGK-IGKVKKGDVLEIYQT---------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          TIAXXTSKDVISTRIRSLKFQKVDEVVAAAGIKIVAPGID--DVXAGSPLRVV-----------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SAEKPLKNRARVRLYLGTDEILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGG
1c82A1          TMYHWIDKSFAPLLVNGELMDMSRGRSISRANSE------------------------------------
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          A-----SRSISRL------EGRDAIRVAVRQXXAPHGYRAWQNVVNAPIIVIEGDHAVLDAQFXVFSILA
1lnzA2          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ---TGFFSGYRPQFYFRTTDVTGVVQLPPGVEVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIEPNAPKHKRYRSEVLEGLAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c82A1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          AEVPDGGWPTGTFGRIVPIEAGQ-----------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          GVVTKI----------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxYNKWRQEIKSMVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAM
1c82A1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          --------------------YQAWWQAVTRALEEFHSRYPLRPGLAREELRSRYFSRLPARVYQALLEEW
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          ----------------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          ------------------------------------------------------------------LVKD


                         *         .         .         .         .         +         .:560
query           EIDGLLKLHDKTLALAEFTGELSGSQQKLVQDMICAIQEGNFQPPSWVEVVKKFRLKDAESQEYLQYFLR
1c82A1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          SREGRLQLAANTVALAGFT---------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          ---------------------------KLLKDLEDKYRVSRWQPPSFKEV----------AEELLHYLVR
1iugA           ----------------------------------------------------------------------
1bs2A2          PIHHLFDVYVRINKDIEEEGDSIPLEQSTNGKAREYFKRMEDGDEEALKIWKRFR------EFSIEKYID


                         .         .         .         *         .         .         .:630
query           TGQLVKLSDDELYYTADRYQQAKTKIVEYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGD
1c82A1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1lvaA2          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1lvaA4          ------------------------EVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGD
1tpzA           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
3ejvA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
1aipA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
2gtvX1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1pvwA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1wsuC1          EGVLVKINDE------------------------------------------------------------
1iugA           ----------------------------------------------------------------------
1bs2A2          TYARLNIKYDVYSGESQVSKESMLKAIDLFKEKGLT----------------------------------


                         .         +         .         .         .         .         *:700
query           NRVLx
1c82A1          -----
1aipA3          -----
1f60A3          -----
1wdtA2          -----
1darA2          -----
1n0uA2          -----
1g7rA4          -----
1o9nA           -----
1puiA           -----
1eniA           -----
1vfgA2          -----
2hgjF1          -----
1nrjB           -----
1q4rA           -----
1upsA2          -----
2fh5B1          -----
1h65A           -----
1nriA           -----
1eg7A           -----
1egaA1          -----
1o94C           -----
1sulA           -----
1wb1A4          -----
1mkyA2          -----
1wb1A1          -----
1zd9A1          -----
1lvaA2          -----
2c31A3          -----
1jxhA           -----
2cxxA1          -----
1xzpA2          -----
1d1nA           -----
1aipA1          -----
1zpdA3          -----
1lvaA4          KRVV-
1tpzA           -----
1darA1          -----
1ni3A1          -----
1um9A           -----
3ejvA1          -----
1lnzA2          -----
1wdtA1          -----
2bmjA1          -----
1g7rA2          -----
1n0uA1          -----
1aipA2          -----
2q22A1          -----
2gtvX1          -----
1p5uB           -----
1yr6A1          -----
1kjzA1          -----
1pujA           -----
1xe1A           -----
1ahjB           -----
1g7rA1          -----
1pvwA           -----
1mkyA1          -----
2p67A1          -----
1wsuC1          -----
1iugA           -----
1bs2A2          -----