[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50753.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1usgA.bssp"
#ERROR : Can't open dsspfile "3ckmA1.bssp"
#ERROR : Can't open dsspfile "1peaA.bssp"
#ERROR : Can't open dsspfile "1dp4A.bssp"
#ERROR : Can't open dsspfile "1jdnA.bssp"
#ERROR : Can't open dsspfile "1n2zA.bssp"
#ERROR : Can't open dsspfile "2gmnA1.bssp"

## Summary of PDB Search
:394
    2e-67  25%  1usgA  [c.93.1.1] LEUCINE-SPECIFIC BINDING PROTEIN
    4e-40  16%  3ckmA1 [c.93.1.1] YRAM (HI1655) A:257 -- 573
    4e-38  17%  1peaA  [c.93.1.1] AMIDASE OPERON
    2e-25  14%  1dp4A  [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    2e-22  13%  1jdnA  [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR
    8e-04  22%  1n2zA  [c.92.2.2] VITAMIN B12 TRANSPORT PROTEIN BTUF
    8e-04  19%  2gmnA1 [d.157.1.1] METALLO-BETA-LACTAMASE A:29 -- 292
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
1usgA           ------------------------------------DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDIN
3ckmA1          ----------------------------------------IGLLLPLSGDGQILGTTIQSGFND------
1peaA           ---------------------------------------LIGLLFSETGVTADIERSQRYGALLAVEQLN
1dp4A           ------------------------------------SDLTVAVVLPLTNTSYPWSWAVGPAVELALARVK
1jdnA           -------------------------------------KIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVE
1n2zA           ----------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
1usgA           AKGGIKGDKLVGVEYDDACDPKQAVAVANKIV-NDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATN
3ckmA1          ---AKGNSTIPVQVFDTSXNSVQDII---AQAKQAGIKTLVGPLLKQNLDVILDPAQIQGXDVLALNATP
1peaA           REGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLCYPTPYE
1dp4A           ARPDLLGWTVRMVLGSSENAAGVCSDTAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPA
1jdnA           G--LPPGTRFQVAYEDSDCGNRALFSLVDRVAAAAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALA
1n2zA           ----------------------------------------------------------------------
2gmnA1          -----------------------------------------------HTGGFAEIKKETGAQLVAGERDK


                         +         .         .         .         .         *         .:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
1usgA           PELT-----QRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKAANA
3ckmA1          --------NSRAIPQLCYYGLSPEDEAESAANKXWNDGVRNPLVAXPQND--LGQRVGNAFNVRWQQLAG
1peaA           GFEY--------SPNIVYGGPAPNQNSAPLAAYLIRHYGER--VVFIGSDYIYPRESNHVMRHLYRQHGG
1dp4A           LGIG----VKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVL--YADRLGDDRPCFFIVEGLYMRV
1jdnA           AGFQ---HKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNC--YFTLEGVHEVFQE
1n2zA           ------------------------------------DKPKKRVFLQFGINPPFTSG-----KESIQNQVL
2gmnA1          LEGGYYPGDEKNEDLAFPAVKVDRADTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRL


                         .         .         .         +         .         .         .:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
1usgA           NVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIA
3ckmA1          TDANIRYY-NLPADVTYFVQENNS-NTTALYAVASPTELAEXKGYLTNIVPNLAIYASSRASASATNTND
1peaA           TVLEEIYIPPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGRRPPIASLTTSEAEVAKME
1dp4A           REVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEVFFHLDVFGQSLKSAQ
1jdnA           LHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTNSSSYGDGSWKRGDKHDF
1n2zA           EVCGGENIFKDSRVPWPQVSQVLARSPQAIVITGGPDQIPKIKYWGEQLKIPVIPLTSDWFERAS-PRII
2gmnA1          --VGQPTYAGIVDDYRATFAKAKAMKIDVL-LGPHPEVYGMQAKAEMKDGAPNPFI--------------


                         .         *         .         .         .         .         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
1usgA           GDAA-EGMLVTMPKRYDQ-DPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKD
3ckmA1          FIAQXNGVQFSDPFFKDTNSPQYQKLAKSTGGEYQLXR--LYAXGAD-AWLLINQFN----------ELR
1peaA           SDVA-EGQVVVAPYFSSIDTPASRAFVQACHGFFPETITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRH
1dp4A           GLVPQKPWERGDGQDR--SARQAFQAAKIITYK-------------------------------------
1jdnA           EAKQAYSSLQTVTLLRT-VKPEFEKFSMEVKSSVEKQGLNMVEGFHDAILLYVLALHEVLRAGYSKKDGG
1n2zA           LAAQ------------------------------------------------------------------
2gmnA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVYKTYVxx
1usgA           LK-ANGANTVIGPLNWDEKGDLKGFDF-----------------
3ckmA1          QVPGYRLSGLTGILSADTNCNVERDXTWYQYQDGAIV-------
1peaA           LYD-IDIDAPQGPVRVEQNNHSRLSSRIAEIDARGVFQVRW---
1dp4A           --------------------------------------------
1jdnA           KIIQQTWNGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVI--
1n2zA           --------------------------------------------
2gmnA1          --------------------------------------------