[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50796.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1or7A2.bssp"
#ERROR : Can't open dsspfile "1h3lA.bssp"
#ERROR : Can't open dsspfile "1iw7F3.bssp"
#ERROR : Can't open dsspfile "1z77A2.bssp"
#ERROR : Can't open dsspfile "1rp3A3.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1aw8.1.bssp"
#ERROR : Can't open dsspfile "1sigA.bssp"
#ERROR : Can't open dsspfile "1rp3A2.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "1c9bA2.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1pdnC.bssp"
#ERROR : Can't open dsspfile "1a04A1.bssp"
#ERROR : Can't open dsspfile "1fseF.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"

## Summary of PDB Search
:200
    2e-22  48%  1or7A2 [a.177.1.1] RNA POLYMERASE SIGMA-E FACTOR A:-1 -- 111
    5e-20  36%  1h3lA  [a.177.1.1] RNA POLYMERASE SIGMA FACTOR
    5e-20  18%  1iw7F3 [a.177.1.1] RNA POLYMERASE SIGMA-70 SUBUNIT F:74 -- 257
    2e-19   6%  1z77A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:76 --
    2e-18  20%  1rp3A3 [a.177.1.1] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA)
    5e-10  23%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    1e-09  21%  1p4wA  [a.4.6.2] RCSB
    2e-09  24%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    2e-09  23%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    3e-09  17%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    1e-07  17%  1aw8.1 [b.52.2.1] L-ASPARTATE-ALPHA-DECARBOXYLASE A:- -- - B:- --
    1e-07  20%  1sigA  [a.177.1.1] RNA POLYMERASE PRIMARY SIGMA FACTOR
    2e-07  24%  1rp3A2 [a.4.13.2] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:164
    4e-07  26%  1fseA  [a.4.6.2] GERE
    1e-06  15%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    2e-06  20%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    3e-06  39%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    5e-06  18%  1c9bA2 [a.74.1.2] GENERAL TRANSCRIPTION FACTOR IIB A:208 -- 316
    6e-06   4%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    5e-04  22%  1pdnC  [a.4.1.5] PROTEIN (PRD PAIRED)
    6e-04  31%  1a04A1 [a.4.6.2] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    7e-04  19%  1fseF  [a.4.6.2] GERE
    8e-04  18%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
1or7A2          -QLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSG-DVPDVVQEAFIKAYRALDSFRGDSAFY
1h3lA           ---------ERSARFERDALEFLDQMY-----SAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLK
1iw7F3          SLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKFKFS
1z77A2          -EADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLXWFFSGFEEVYLR
1rp3A3          ---------MKNPYSNQIEREELILKYLPLVKAIATNILPEDVDIRDLISYGVIGLIKAVDNLSTEKRAE
1k78A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1aw8.1          --------------------RTMLQLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTKRFS
1sigA           ---QVKDINRRMSIGEAKAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFRRGYKFS
1rp3A2          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1c9bA2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1pdnC           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TWIYHITVNVCRDELRKRQRRPTVxxxxxxxxxxxxxxxxxxxNDPGPEEMLDRSETQAMIQACLNTLSD
1or7A2          TWLYRIAVNTAKNYLVAQGRRPPS----------------------------------------------
1h3lA           AWLYRILTNTFINSYR------------------------------------------------------
1iw7F3          TYATWWIRQAINRAIADQAR--------------------------------------------------
1z77A2          TYKPELLKRDXNTLVEEVKVXLRI----------------------------------------------
1rp3A3          AYIKLRIKGAIYDYLRSL----------------------------------------------------
1k78A1          -------------------------------------------------------NQLGGVFVNGRPLPD
1p4wA           -----------------------------------------------PESVAKLLEKISAGGYGDKRLSP
1yioA1          -------------------------------------------------------ETQDQLEQLFSSLTG
1ku3A           ------------------------------------------------------------LEKALSKLSE
1iw7F2          -------------------------------------------HLPSPVDAATQSLLSEELEKALSKLSE
1aw8.1          TYAIAAERGSRIISVNGAAAHC------------------------------------------------
1sigA           TYATWWIRQAITRSIADQ----------------------------------------------------
1rp3A2          -----------------------------------------------VEEEVIKRELTEKVKEAVSKLPE
1fseA           ----------------------------------------------------------------KPLLTK
1tc3C           ------------------------------------------------------------------ALSD
1h0mA1          ------------------------------------------------------------------WLDP
1or7A1          --------------------------------------------------LMLSEELRQIVFRTIESLPE
1c9bA2          ----------------------------------------------------------------------
2dk5A1          ------------------------------------------------------------NAGKMKGSDN
1pdnC           -------------------------------------------------------------------LPN
1a04A1          ----------------------------------------------------------------VNQLTP
1fseF           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALKEKISKQMELITPAKRLAK
1or7A2          ------------------------------------------------------------
1h3lA           ------------------------------------------------------------
1iw7F3          ------------------------------------------------------------
1z77A2          ------------------------------------------------------------
1rp3A3          ------------------------------------------------------------
1k78A1          VVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETG-------------------
1p4wA           KESEVLRLF-AEGFLVTEIAKKLNRSIKTISSQKKSAMMKL--GVDNDIALLNYLSSV--
1yioA1          REQQVLQLT-IRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANL-----------
1ku3A           REAMVLKMRDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHES--------------
1iw7F2          REAMVL-KLRKGLIDGEEVGAFFGVTRERIRQIENKALRKLKYHESRTR-----------
1aw8.1          ------------------------------------------------------------
1sigA           ------------------------------------------------------------
1rp3A2          REKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREML---------------
1fseA           REREVFELL-VQDKTTKEIASELFISEKTVRNHISNAMQKL--GVKGRSQAVVELLRM--
1tc3C           TERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGT------------------
1h0mA1          KEATYLRWI-AVGKTXEEIADVEGVKYNSVRVKLREAXKRF--DVRSKAHLTALAIRR--
1or7A1          DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNK----------------
1c9bA2          ---------------QKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQ
2dk5A1          QEKLVYQIAGNKGIWSRDVRYKSNLPLTEINKILKN------------------------
1pdnC           NIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGV-------------
1a04A1          --RERDILKLIQGLPNKMIARRLDITESTVKVHVKHMLKKMKLK----------------
1fseF           -------------LTKREREVFELLVQDKVRNHISNAMQKL--GVKGRSQAVVELLRM--
1resA           --DRDAVLNMWQQLGASHISKTMNIARSTVYKVINE------------------------