[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50877.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1qvvA.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1u9cA.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "1g2iA.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1s1mA1.bssp"
#ERROR : Can't open dsspfile "2fexA1.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1suwA.bssp"

## Summary of PDB Search
:233
    3e-23  26%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    3e-21  17%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    6e-19  20%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    3e-17  22%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    6e-17  16%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    7e-16  20%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    1e-14  15%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    2e-14  14%  1qvvA  [c.23.16.2] YDR533C PROTEIN
    7e-14  18%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    5e-13  21%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    6e-13  15%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    1e-12  17%  1u9cA  [c.23.16.2] APC35852
    1e-12  15%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    1e-11  17%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    3e-10  35%  1g2iA  [c.23.16.2] PROTEASE I
    1e-09  12%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    7e-09  33%  1s1mA1 [c.23.16.1] CTP SYNTHASE A:287 -- 544
    3e-08  29%  2fexA1 [c.23.16.2] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 188
    3e-08  12%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    1e-07  15%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    5e-05  11%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    8e-04  25%  1suwA  [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
1t3tA2          -KVAVLREQGVNSHVEMAAAFHRA-GFDAIDVHMSDLLGGNFHALVACGGFSYGDVLGAGEGWAKSILFN
1l9xA           ---------------------------RLDLTKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYNLS
1jvnA2          MPVVHVIDVESGNLQSLTNAIEHL-GYEVQLVKSPKDFISGTSRLILPGVGNYGH---FVDNLFNRGFEK
1q7rA           -KIGVLGLQGAV--REHVRAIEAC-GAEAVIVKKSE-QLEGLDGLVLPGGESTTXRRL----IDRYGLXE
1gpwB           MRIGIISV-GPGNIMNLYRGVKRA-SENFEDVSIELVESPLYDLLFIPGVGHFGEGMRRL---RENDLID
1ka9H           ----LLIDYGSGNLRSAAKALEAAGFSVA--VAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGF---VE
1fy2A           -SAVFIPFAGVTQTWDEAEVLAPL-GVNVTGIHRVADPIEKAEIIIVGGGNTF----QLLKESRERGLLA
1qvvA           EHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFFASAGHGTLFDYPAKDLQDI-----
1j42A           ------------LAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
1qdlB           -------------------------GSYPIVIRNDEISIKGPDRLIISPGPG--TPEKREDI----GVSL
1wl8A1          MMIVIMDNGGQYVHRI-WRTLRYL-GVETKIIPNTT-PLEEIKAMNPKGIIFSGGP----SLENTGNCEK
1u9cA           ----VPLDPRSINEKDPSWAEAEAALKHTARLSK--DDAHGFDAIFLPGGHGTMFDFPDNE-----TLQY
1i1qB           -DILLLDNIDSFTWNL-ADQLRNVVIYRNHIPAQTLIDTMKNPVLMLSPGPGVPSEAGC---------MP
1o1yA           VRVLAIRHVEIEDLGXXEDIFREK-NWSFDYLDTPKGELEEYSLVVLLGGYX-GAYEEEKYP-FLKYEFQ
1g2iA           ---------------------GTITGKHVDLTFDKV-NPEEFDALVLPGGRA-PERVRLNE-----KAVS
2ghrA1          ---------------------------------------EKFDGLIITGAPV--ETLSFEEVDYWEELKR
1s1mA1          --------------------------------------LKGLDAILVPGGFGYRGVEGMITTAR------
2fexA1          -----------------------------------------IDALVIPGGLS-WEKGTAADLGGL-----
1sy7A1          -------------------KVTAANGSTVQPHHLEGFRSTMVDAIFIPGGAKAAETLS-----KNGRALH
1gpmA2          ---------------------------------------FNPSGIILSGGP--ESTTEENSPR-------
1aa7A           -----------------------------------------RRRFVQNALNGNGDP----NNMDKAVKLY
1suwA           MRAAVVYKTDGHVKRIE-EALKRL-EVEVELFNQPSEELENFDFIVSVGGD--------GTILR------


                         .         .         *         .         .         .         .:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
1t3tA2          HRVRFHRPQTLALGVXNGCQMMSNLRELIPGFVRNHSDRFEARFSLVEVTQSPSLLLQGMVGSQMPIAVS
1l9xA           IQSFDDGDYFPVWGTCLGFEELSLLISGEC-LLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAV
1jvnA2          PIREYIESGKPIMGIXVGLQALFAGNYIDFKLSRFDDSEKVPEIGWNSCIPSENLFFGLDPY---KRYYF
1q7rA           PLKQFAAAGKPXFGTCAGLILLAKRIVGYD--------EPHLGLXDITVERNSFGRQRESFEAELSIKGV
1gpwB           FVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVV-------------------------KL
1ka9H           RVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLG----LVPGEVRRFRAGRVPQMGWNALEFGGAFAP
1fy2A           PMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLF---PLQINPHFTNTREQRIRELLV
1qvvA           -ASEIYANGGVVAIFDGLTDKKTGRPLIEGKGFTDVGETILGVDSILKAKNLATVEDVAKKYGAKYLAPV
1j42A           ILKEQENRKGLIAAICAGPTALLAHEIGCGS----KVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR
1qdlB           DVIKYLGKRTPILGVCLGHQAIGYA--FGAKIRRARKVFHGKISNIILVNNS--PLSLYYGIAKEFKATR
1wl8A1          VLEHYDEFNVPILGICLGHQLIAKF--FGGKVGRGEKAEYSLVEIEI--------------IDEEIFKGL
1u9cA           VLQQFAEDGRIIAAVXHGPSGLVNATYKDGTPIVKTVTSFTDEEEREVGLDVHMPFL--------LESTL
1i1qB           ELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQILHGKATSIEHDGQAMFAGLANPLPVARYHSSNVPAGL
1o1yA           LIEEILKKEIPFLGIXLGSQXLAKV---LGASVYRGKNGEEIGWYFVEKVSDNKFFREFPDRLRV-----
1g2iA           IARKXFSEGKPVASICHGPQILISAGVLRG----------------------------------------
2ghrA1          IXEYSKTNVTSTLHICWGAQAGLYH--HYGVQKYPLKEKXFGVFEHEVREQHVKLLQGFDELFFAP----
1s1mA1          ----FARENNIYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEW--------------
2fexA1          -VKRFRDRDRLVAGICAAASALGGTGVLNDVAHTGNALAS--HKAYPAYRGE------------------
1sy7A1          WIREAFGHLKAIGATGEAVDLVAKAIALPQ----VTVSSEAEVHESYGVVTLKKVKPESFTDAVKI---A
1gpmA2          APQYVFEAGVPVFGVCYGMQTMAMQL--GGHVEASNEREFGYAQVEVVNDSAL-----VRGIEDALTADG
1aa7A           RKLKREITFHGAKEISLSYSAGALA--SCMGLIYNRMGAVTTEVAFGLVC--------------------
1suwA           -ILQKLKRCPPIFGINTGRV--------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
1t3tA2          HGEGRVEVRDDAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPERVFRT
1l9xA           EPLTANFHKWSLSVKNFTMNEKLK------KFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYE
1jvnA2          VHSFA-AILNSEKKKNLENDGWKI------------AKAKYGSEEFIAAV--NKNNIFATQFHPEKSGK-
1q7rA           GDGFVGVFIRAPHIVEAGDGVDVLATYND------------------RIVAARQGQFLGCSFHPE-----
1gpwB           RSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEELGTTEYDGEIFPSAVRKGRILGFQFHPEKSSK-
1ka9H           LTGRHFYFANSY---YGPLTPYSLGKGEYE--------------GTPFTALLAKENLLAPQFHPEKSGK-
1fy2A           VA-------PELTVIGLPEGNWIQVSNG-----------------QAVLGGPNTTWVFKAGEEAV-----
1qvvA           GPWDDYSITDGRLV--------------------------------------------------------
1j42A           GPGTSFEFA--LAIVEALNGKEVAAQVKAPL---------------------------------------
1qdlB           YHS--------LVVDEVHRPLIVDAISAEDN--------------EIMAIHHEEYPIYGVQFHPESVGTS
1wl8A1          PKRLKVWESHMDEVKELPPKFKILARSETXPIEA---------------MKHEELPIYGVQFHPEVAHTE
1u9cA           RLRGANFVRGGKWTDFSVRDGNLI----------------------------------------------
1i1qB           TINAHFN-------------------------------------GMVMAVRHDADRVCGFQFHPESILTT
1o1yA           ------FQWHGDTF----DLPRRATRVFTSEKYENQGF--------------VYGKAVGLQFHIEVGAR-
1g2iA           ----------------------------------------------------------------------
2ghrA1          ---HSRHTEVRESDIREVKELTLLAN------------SEEAGV---HLVIGQEGRQVFALGHSEY-SCD
1s1mA1          ----------------------------------------------------------------------
2fexA1          ----------------------------------------------------------------------
1sy7A1          KGAAGFLGEFFYAIAQHRNWDRELDGL-------------------------------------------
1gpmA2          KPLLDVWMSHGDKVTAIPSDFITVASTES---------------CPFAIMANEEKRFYGVQFHPEVTHTR
1aa7A           ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILGNIDGQLIFKSLLETWQRRCG
1t3tA2          ----VANSWHPENWGED------
1l9xA           -WKNLDGISHAPNAVKTAFY---
1jvnA2          -----AGLNVIENFLK-------
1q7rA           -----------------------
1gpwB           -----IGRKLLEKVIECSLSR--
1ka9H           -----------------------
1fy2A           -----------------------
1qvvA           -----------------------
1j42A           -----------------------
1qdlB           -----LGYKILYNFLN-------
1wl8A1          -----KGEEILRNFAK-------
1u9cA           -----------------------
1i1qB           -----QGARLLEQTLAWAQQK--
1o1yA           -----TXKRWIEAYKDELEKKKI
1g2iA           -----------------------
2ghrA1          TLKQEYERDRDKGL---------
1s1mA1          -----------------------
2fexA1          -----------------------
1sy7A1          -----------------------
1gpmA2          -----QGMRMLERFVR-------
1aa7A           -----------------------
1suwA           -----------------------