[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50885.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1a9xB2.bssp"
#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1gpmA3.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1ee1A.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "1xr4A2.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "2pg3A1.bssp"
#ERROR : Can't open dsspfile "1suwA.bssp"
#ERROR : Can't open dsspfile "1t8hA.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"
#ERROR : Can't open dsspfile "1yqeA1.bssp"

## Summary of PDB Search
:513
    3e-42  47%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    2e-38  58%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    1e-37  27%  1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    9e-37  21%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    6e-36  17%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    1e-35  24%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    2e-35  18%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    4e-35  42%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    1e-32  16%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    1e-32  17%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    2e-32  14%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    3e-32  14%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    1e-31  19%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    2e-31  21%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    4e-29  18%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    7e-29  15%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    2e-27  15%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    2e-26  53%  1gpmA3 [d.52.2.1] GMP SYNTHETASE A:405 -- 525
    2e-26  21%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    2e-25  11%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    2e-24  10%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    2e-23  17%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    5e-22  20%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    4e-19   4%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    9e-19  27%  1ee1A  [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    5e-18  10%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    6e-16  13%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    8e-16  16%  1xr4A2 [c.124.1.2] PUTATIVE CITRATE LYASE ALPHA CHAIN/CITRATE-ACP
    3e-13   8%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    3e-09  22%  2pg3A1 [c.26.2.1] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC A:1 -- 230
    7e-09  16%  1suwA  [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
    9e-08  13%  1t8hA  [d.194.1.2] YLMD PROTEIN SEQUENCE HOMOLOGUE
    3e-06  22%  1surA  [c.26.2.2] PAPS REDUCTASE
    6e-06  11%  1yqeA1 [c.56.7.1] HYPOTHETICAL UPF0204 PROTEIN AF0625 A:1 -- 278
:513

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
1gpmA2          --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
1gpmA1          ----------------------------------------------------------------------
1a9xB2          --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDYAITA
1xngA1          ----------------------------------------------------------------------
1jvnA2          --------VHVIDVESGNLQSLTNAIEHLGYEVQLVKS---PKDFNISGTSRLILPGVGNNLFNRGFEKP
1qdlB           --------TLIIDNYDSFVYNIAQIVGELGSYPIVIRNDISIKGIERIDPDRLIISPGPGTPEKREDIGV
1jgtA1          ----------------------------------------------------------------------
1wl8A1          --------IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
1o1yA           --------VLAIRHVEIEDGXXEDIFREKNWSFDYLDTPKGEKLERPLEEYSVVLLGGYXGAYEEEEFQL
2ghrA1          --------IAILNLXPQLLRLIGNTPLQLDVLHXESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDY
1q15A1          ----------------------------------------------------------------------
1l9xA           --LMQKCRNKVMKNYGRYYASYVKYLESAGARVVPVRLDLTEKDYEFKSINGILFPGGSVDLRRSDYAKV
1q7rA           --------IGVLGLQGAVREHV-RAIEACGAEAVIVKKSEQLEG-----LDGLVLPGGESTTXRRLIDRY
1i1qB           --------ILLLDNIDSFTWNLADQLRTNGHNVVIYRNHTLIDRLATMKNPVLMLSPGPGVPSEAGCMPE
2c5sA1          ----------------------------------------------------------------------
1t3tA2          IATGARPKVAVLREQGVNSVEMAAAFHRAGFDAIDVHMSLLGGRIGLGNFHALVACGGFSYGDVLGAGEF
1gpwB           --------IGIISVGPGNIMNLYRGVKRASENFEDVSIE-LVESPRNDLYDLLFIPGVGHFGEGMRRLRE
1gpmA3          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1fy2A           ------------QTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAA-IEKAEIIIVGGGNTFQLLKESRER
1k92A1          ----------------------------------------------------------------------
1ka9H           --------ALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAH-----EEADLLVLPGQGHFGQVMRAFQE
1wy5A1          ----------------------------------------------------------------------
1aa7A           --------DVFAGKNTDLEVLMEWLKTRPILSPLGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKA
1ee1A           ----------------------------------------------------------------------
1j42A           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1sy7A1          -------------------LVIGPRRSKVTAANGSTQPHHHLEGFRSTMVDAIFIPGGAKAAENGRALHW
2pg3A1          ----------------------------------------------------------------------
1suwA           --------AAVVYKTDGHVKRIEEALKRLEVEVELFNQ----PSEELENFDFIVSVGGDGTILRILQ---
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
1gpmA2          PQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIKPLLDVWMSHGDKVTA
1gpmA1          ----------------------------------------------------------------------
1a9xB2          IQKFLETDIPVFGIXLGHQLLALASGAKTVKMKFGHHGGN----HPVKDVEKNVV--MITAQNHGFAVDE
1xngA1          ----------------------------------------------------------------------
1jvnA2          IREYIESGKPIMGIXVGLQALFAYIDFKLSRFDDSEKPIGWNSCIPSENLFFGLDPYKRYYFVHSFAAIN
1qdlB           SLDVIKYRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKETRYHSLVVDE
1jgtA1          ----------------------------------------------------------------------
1wl8A1          LEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEI-IDEEIFKGLPKRLKVWESHMDEVKE
1o1yA           IEEILKKEIPFLGIXLGSQXLAKVLGASVYRGNGEEIGWYFVEKVSDNKFFREFPDRLRVFQWHGDTF-D
2ghrA1          WEELKRIVTSTLHICWGAQAGLYHHYGVQKYPLKKXFGVFEHEVREQHVKLELFFAPHSRHTEVRESDIR
1q15A1          ----------------------------------------------------------------------
1l9xA           AKIFYNLYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTSVKNFTMNEK
1q7rA           GKQFAAAGKPXFGTCAGLILLAKRIVGYDEPHLGRNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVE
1i1qB           LLTRLRGKLPIIGICLGHQAIVEAYGGYV---GQILHGKATSIEHDGQAMFAGLANPLPVARYHSSNVPA
2c5sA1          ----------------------------------------------------------------------
1t3tA2          ETFFHRPQTLALGVXNGCQMMSNLRELIPGSELWPRFVRNGRVEVRDDAHLAALESKGLVALRYVDNFGK
1gpwB           NDKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLGWNEVIFKDTFPNGYYYFVHTYRAVC
1gpmA3          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1fy2A           GADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNTRELLVVAPELTVIG
1k92A1          ----------------------------------------------------------------------
1ka9H           SGRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGFGGAFAPLTGRHFYFANSYYG-P
1wy5A1          ----------------------------------------------------------------------
1aa7A           VKLYEITFHGAKEISLSYSAGALASCMGLIYNRMVAFGLVCA----------------------------
1ee1A           ----------------------------------------------------------------------
1j42A           LKEQENRKGLIAAICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTS
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1sy7A1          IREAFGHLKAIGATGEAVDLVAKAIALPQVTVSSEAEVHESYGVVTLKKVKPESFTDAVKIAKGAAEFFY
2pg3A1          ----------------------------------------------------------------------
1suwA           ---KLKRCPPIFGINTGRVGL-------------------------------------------------
1t8hA           -----------------------------------------------------------VCCEHGADIQK
1surA           ----------------------------------------------------------------------
1yqeA1          ---------------------------------------------------------------VSGNVGT


                         +         .         .         .         .         *         .:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVK
1gpmA2          IPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEA-------------
1gpmA1          ----------------------------------------------------------WTPAKIIDDAVA
1a9xB2          LPANLRVTHKSLDGTLQGIHRTDKPAFSFQGNPEASPGPDAAPLFDHFI---------------------
1xngA1          ---------------------------------------------------------------YLCDFLE
1jvnA2          LENDGWKIAKAKYGSEEFIAAVNKNIFATQFHPEKSGKA-GLNVIENFLKQQSPPIPNYSA---------
1qdlB           VHRPLIVDASAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV------------------
1jgtA1          ----------------------------------------------------------------LEKAV-
1wl8A1          LPPKFKILARSETXPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFA-KLCG----------------
1o1yA           LPRRATRVFTSEKYENQGFVY--GKAVGLQFHIEVGART-XKRWIEAYKDELEKKKIDPRLLLETAEREE
2ghrA1          EVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEY-----------------------------------
1q15A1          --------------------------------------------------------------ALIDRYLN
1l9xA           LKKFFNVLTTNTIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDG--ISHAPNAVKTAFYLAEFFVNEAR
1q7rA           AGDGVDVLATYNDRIVAAR---QGQFLGCSFHPELTDDHRLXQ---YFLNXVKEAKXASSL---------
1i1qB           ----GLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTL-AWAQQ---------------
2c5sA1          ----------------------------------------------------------------------
1t3tA2          VTETYPANPNGSPNGITAVTTENGRVTIMMPHPERVFRTVAN----SWHPENWGEDSPWMR--IFRNARK
1gpwB           EEEHVLGTTEYDGEIFP-SAVRKGRILGFQFHPEKSSKI-GRKLLEKVI---------------------
1gpmA3          ----------------------------------------------------------------------
1ni5A1          -------------------------------------------------------------------TLT
1fy2A           LPEGNWIQVSNG--QAVLGGPNTTWVFKAGEEAVALEAG-------------------------------
1k92A1          ----------------------------------------------------------------------
1ka9H           LTPYSLGKGEYEGTPFTAL-LAKENLLAPQFHPEKSGKA-GLAFLALAR---------------------
1wy5A1          ----------------------------------------------------------------VLALQN
1aa7A           ----------------------------------------------------------------------
1ee1A           --------------------------------------------------------------------LK
1j42A           FEFALAIVEALNGKEVAAQ---------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1sy7A1          AIAQHRNWDRELDGLHSMI---------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1t8hA           VDRGNGAQDFATAVPGVDGLYTDEAGVLL-----ALCFADCVPIYAPSAGLVGLAHAGWTAGGIAGHMVW
1surA           ------------------------------------------------------------------GRVA
1yqeA1          ADFGGKPYSLAKPSPQTNYVLALRERLDRKPEFEFTHHGPSEISKPSAFYEIGSTEEEWKDEVVAEAMLD


                         .         .         .         +         .         .         .:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
1gpmA2          ----------------------------------------------------------------------
1gpmA1          RIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVP
1a9xB2          ----------------------------------------------------------------------
1xngA1          KEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALN-LCEKFSIPYTEYS
1jvnA2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jgtA1          -AQRVTPGDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTSNEFREARAVVD----HLRTRHREIT
1wl8A1          ----------------------------------------------------------------------
1o1yA           KVLK------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1q15A1          ALEDLAPFDTVGIPLSGGLDSSLVTALASRHFKKLNTYSIGTELSNEFEFSQQVADALTHHQMKILSETE
1l9xA           KNNHHFKSESEE----------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2c5sA1          -------GGKVMVLLSGGIDSPVAAYLTMKR-GVSVEAVHFHSPPFTSERAKQKVIDLAQELTKYCKRVT
1t3tA2          QL--------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1ni5A1          LNRQLLTSRQILVAFSGGLDSTVLLHQLVQWPGVALRAIHVHHGLSANADAWTHCENVCQQWQVPLVVER
1fy2A           ----------------------------------------------------------------------
1k92A1          -ILKHLPGQRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEEDYDAIPRRAM-EYGAENARKQ
1ka9H           ----------------------------------------------------------------------
1wy5A1          DEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYEVALAHFNHMLRESARDEEFCKEFAKERNMKIFVGK
1aa7A           ----------------------------------------------------------------------
1ee1A           QYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVEAQFIAVRLPHGTQQDEDDAQLA--------LKFIKPD
1j42A           ----------------------------------------------------------------------
1vbkA1          -------EGRMIGILHDELSALAIFLMMKRGV--EVIPVYIGKDDKNLEKVRSLWNLLKR----------
1xr4A2          ----------TAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRA-AGVALXTIE
1sy7A1          ----------------------------------------------------------------------
2pg3A1          --------KRAVVVFSGGQDSTTCLIQALQD-YDDVHCITFDYG--QRHRAEEVAQELSQKLGAAAHKVL
1suwA           ----------------------------------------------------------------------
1t8hA           LWQTREHIAPSIGPCCYTVDDRVVDSLRPTLPPESPLPWRETALDLKEANRLQL-----LAAGVPNSHIY
1surA           WALDNLPGEYVL-SSSFGIQAAVSLHLVNQI-RPDIPVILTDTGYLFP-ETYRFIDELTDKLKLNLKVYR
1yqeA1          AIRAEKMDWNVAVGVGGTHYAPRQTEIMLTT-TFTFGHNFAKYT-FEHLTAEFLVKAVKL-SEAEYIIID


                         .         *         .         .         .         .         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
1gpmA2          ----------------------------------------------------------------------
1gpmA1          AEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIES---------------
1a9xB2          ----------------------------------------------------------------------
1xngA1          IAPYDAIFSSHFKDASLTRKFCARLRMAFLYDYSLKSD---SLVIG------------TSNKSERMLGYG
1jvnA2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jgtA1          IPTTELLAQLESVDPDIIEYLLPLTALYRALDGPERRYGADIPLGGMHREDRLPALTVLAHDMATFDGLN
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1q15A1          VINGIIESIYYNEIFDGLSAEIQSGLFNVYRQAQGQVSCMDLLFGGILKPGAQYDNQLLAEQVYRTRWTG
1l9xA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2c5sA1          LHLVPFTEVQKTINKEIPSSYSMTVMRRMMMRITERIAEALAITTGESLGQVASQ---------TLDSMH
1t3tA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1ni5A1          -----------VQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCETFLKRGSGPAGLSAXA
1fy2A           ----------------------------------------------------------------------
1k92A1          LVAEGIAAIQCGAFHNTTGGLTYFNTTPLGVAAMKEDG-VNIWGDGSTYKGNDIER---FYRYGLLTNAE
1ka9H           ----------------------------------------------------------------------
1wy5A1          EDVRAFAKENRMSLEEAGRFLRYKFLKEILESEG-----FDCIATAHHLNDLLE--TSLLFFTRGTGLDG
1aa7A           ----------------------------------------------------------------------
1ee1A           KSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGKAR----TRMIAQYAIQEGLLVLGTDAAEAVTGFFTKY
1j42A           ----------------------------------------------------------------------
1vbkA1          ------------YSYGSKGFLVVAESFDRVLKLIRD-FGVKGVIKGLRPNDLNS----EVSEITEDFKMF
1xr4A2          QLQQRAEQLTGKPQPIETDRVVA-----------------------------------------------
1sy7A1          ----------------------------------------------------------------------
2pg3A1          DVG-LLNELATLTRDSIPRNILFLTLASIY-AYQVGAEAVITGVCETGYPD------CRDEFVKALNQAI
1suwA           ----------------------------------------------------------------------
1t8hA           VSER------------------------------------------------------------------
1surA           ATE-------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
1gpmA2          ----------------------------------------------------------------------
1gpmA1          ----AAKMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFP----------------------------
1a9xB2          ----------------------------------------------------------------------
1xngA1          TLFGDLACAI-NPIGELFKTEVYELARRLNIPKKILNKPPFVGQGYPYSVIDPLLK-DIEALFQTKPIDT
1jvnA2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jgtA1          EMSPVLSTLAGHWTTHPYWDR-EVLDLLVSLEAGLKRRHGRDKWVLRAAMADALPAE-------------
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1q15A1          EFATHGASCYGIDIRHPFWSH-SLISLCHALHPDYKIFDNEVKNIL-----------------REYADSL
1l9xA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2c5sA1          TINEVTNYPVIRPLITMDKLEIIKIAEEIGTY---DISIRPYKPKREKANRFEAKYDFTPLIDEAVANKE
1t3tA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          ------------------------------------------GPGLGVRVLGEVKKEYCDLLRRADAIFI
1ni5A1          EVSEFAGTRLIRPLLARTRGELVQWARQYDLRQDDSYDRNFRWPHFAEATAR-----SAALCAEQE----
1fy2A           ----------------------------------------------------------------------
1k92A1          LQIYKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVEK-------------------------------
1ka9H           ----------------------------------------------------------------------
1wy5A1          LIGLPKEEVIRRPLYYVKRSEIEEYAKFKGLR--------------------------------------
1aa7A           ----------------------------------------------------------------------
1ee1A           G---DGGADL-LPLTGLTKRQGRTLLKELGAPERLYLKEP------------------------------
1j42A           ----------------------------------------------------------------------
1vbkA1          PVP------VYYPLIALPEEYIKSVKERLG----------------------------------------
1xr4A2          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
2pg3A1          VLGIARDIRFETPLXWLNKAETWALADQLDTVRYHTL---------------------------------
1suwA           ----------------------------------------------------------------------
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
1gpmA2          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1xngA1          ETLAQLGYDEILVKNI------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jgtA1          ------TVNRPKLSSFSRLLLDH--GVAEDRVHEAKRQVVREL--FDLTVGGGRHPSEVDTDDVVRSVAD
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1q15A1          QLLPKDIVWRSVNQAFANVLGSTVDNYQTKSR-FTYRVYQAFLRGRLSITDVTPSQLKDLI---------
1l9xA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2c5sA1          TMVLQT----------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          EELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIIN
1ni5A1          ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1ee1A           ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EVAEINRVVYDITSKPPGTIEWE
1gpmA2          -----------------------
1gpmA1          -----------------------
1a9xB2          -----------------------
1xngA1          -----------------------
1jvnA2          -----------------------
1qdlB           -----------------------
1jgtA1          -----------------------
1wl8A1          -----------------------
1o1yA           -----------------------
2ghrA1          -----------------------
1q15A1          -----------------------
1l9xA           -----------------------
1q7rA           -----------------------
1i1qB           -----------------------
2c5sA1          -----------------------
1t3tA2          -----------------------
1gpwB           -----------------------
1gpmA3          EVNGISRVVYDISGKPPATIEWE
1ni5A1          -----------------------
1fy2A           -----------------------
1k92A1          -----------------------
1ka9H           -----------------------
1wy5A1          -----------------------
1aa7A           -----------------------
1ee1A           -----------------------
1j42A           -----------------------
1vbkA1          -----------------------
1xr4A2          -----------------------
1sy7A1          -----------------------
2pg3A1          -----------------------
1suwA           -----------------------
1t8hA           -----------------------
1surA           -----------------------
1yqeA1          -----------------------