[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50894.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1af7A2.bssp"
#ERROR : Can't open dsspfile "1af7A1.bssp"
#ERROR : Can't open dsspfile "2i6gA1.bssp"
#ERROR : Can't open dsspfile "1xtpA.bssp"
#ERROR : Can't open dsspfile "2p7hA1.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"

## Summary of PDB Search
:256
    2e-51  34%  1af7A2 [c.66.1.8] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER A:92
    3e-13  30%  1af7A1 [a.58.1.1] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER A:11
    9e-07  20%  2i6gA1 [c.66.1.44] PUTATIVE METHYLTRANSFERASE A:1 -- 198
    4e-05  28%  1xtpA  [c.66.1.42] LMAJ004091AAA
    6e-05  26%  2p7hA1 [c.66.1.41] HYPOTHETICAL PROTEIN A:21 -- 249
    3e-04  12%  1e50A  [b.2.5.6] CORE-BINDING FACTOR ALPHA SUBUNIT
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTxNVSE
1af7A2          ------------------------------------------------------------------NLTA
1af7A1          --HFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALT-----
2i6gA1          ----------------------------------------------------------------------
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
1af7A2          FFREAHHFPILAEHARRR----HGEYRVWSAAASTGEEPYSIAITLADALGMARWKVFASDIDTEVLEKA
1af7A1          ----------------------------------------------------------------------
2i6gA1          ----------------------------------------------------------------------
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
1af7A2          RSGIYRLSELKTLSPQQLQRYFMPHEGLVRVRQELANYVEFSSVNLLEKQYNGPFDAIFCRNVMIYFDKT
1af7A1          ----------------------------------------------------------------------
2i6gA1          --------------------------------------LQTDLVDLNTLTFDGEYDFILSTVVXXFLEAQ
1xtpA           --------------------------------------GKFILASXETATLPPNYDLIVIQWTAIYLTDA
2p7hA1          ----------------RLQEHFNVEASEEAISHRLKDGITYIHSRFEDAQLPRRYDNIVLTHVLEHIDDP
1e50A           -----------------------------------------------GELVRTDPNFLCSVLPTHWRCNK


                         .         .         .         +         .         .         .:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRxx
1af7A2          TQEDILRRFVPLLKPDGLLFAGHSENFSNLVRE-FSLRGQTVYA--
1af7A1          ----------------------------------------------
2i6gA1          TIPGLIANXQRCTXPGGYNLIVAAEGELRRYYEGWDXL--------
1xtpA           DFVKFFKHCQQALTPNGYIFF--KENCSDR--FLVDKEDSSLTR--
2p7hA1          VAKRINDDW---LAEGGRLFL-------------------------
1e50A           TLPIAFKVVALGDVPDGTLV--------------------------