[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for dred0:ABO50917.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lkvX.bssp"
#ERROR : Can't open dsspfile "1qc7A.bssp"
#ERROR : Can't open dsspfile "2ouxA1.bssp"
#ERROR : Can't open dsspfile "2yvxA1.bssp"

## Summary of PDB Search
:337
    2e-61  54%  1lkvX  [a.118.14.1] FLAGELLAR MOTOR SWITCH PROTEIN FLIG
    4e-31  68%  1qc7A  [a.118.14.1] PROTEIN (FLIG)
    3e-13  12%  2ouxA1 [a.118.26.1] MAGNESIUM TRANSPORTER A:6 -- 135
    7e-07  26%  2yvxA1 [a.118.26.1] MG2+ TRANSPORTER MGTE A:7 -- 131
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lkvX           ----------------------------------------------------------------------
1qc7A           ----------------------------------------------------------------------
2ouxA1          ----------------------------------------------------------------------
2yvxA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRKTDPRHILSFIREEHPQTIAFVLSYL
1lkvX           ----------------------------------------------DPVQLVNFLQSEHPQTIAVVLSYL
1qc7A           ----------------------------------------------------------------------
2ouxA1          ------------------------------------------LKNQQXNEFRELFLALHIYEQGQFYQSL
2yvxA1          ------------------------------------------LQEGDTRALREVLEEIHPQDLLALWDEL


                         +         .         .         .         .         *         .:210
query           KPDQAAVILAELDSQLQSEVARRVAILDRISPDXXXXXXXXXXXXXXSVAQHEETVVGGVQCLVNILNRV
1lkvX           DPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNL
1qc7A           ----------------------------------------------------------------------
2ouxA1          DEKDRQHLYNYLSPKELADXFDVIEEDNENXKDYLAEXRPSYAA--------DXLAEXYTDNAVDLLNXL
2yvxA1          KGEHRYVVLTLLPKAKAAEVLSHLS---------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRSTEKTIFEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
1lkvX           DRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK
1qc7A           --------------------------MFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK
2ouxA1          DKSQKAKYLSLL---SSEEAGEIKELL-------------------------------------------
2yvxA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV
1lkvX           NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIAR--------
1qc7A           NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIARGGGEELIM
2ouxA1          ---------------------------------------------------------
2yvxA1          ---------------------------------------------------------